Conserved Protein Domain Family
PRK13758

?
PRK13758: PRK13758 
anaerobic sulfatase-maturase; Provisional
Statistics
?
PSSM-Id: 172296
View PSSM: PRK13758
Aligned: 3 rows
Threshold Bit Score: 675.093
Threshold Setting Gi: 118444880
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
110800028   1 MPPLSLLIKPASSGCNLKCTYCFYHSLSDNRNVKSYGIMRDEVLESMVKRVLNEANGHCSFAFQGGEPTLAGLEFFEKLM 80 
18309617    1 MPPLSLLIKPASSGCNLKCTYCFYHSLSDNRNVKSYGIMRDEVLESMVKRVLNEADGHCSFAFQGGEPILAGLEFFERLM 80 
118444880   1 MKSLSMLIKPASSNCNLRCTYCFYYDICNNREIKSFGMMKLNLLETIVKRAFNEAEQNCTFAFQGGEPTLVGIDFYREFI 80 
110800028  81 ELQRKHNYKNLKIYNSLQTNGTLIDESWAKFLSENKFLVGLSMDGPKEIHNLNRKDCCGLDTFSKVERAAELFKKYKVEF 160
18309617   81 ELQRKHNYKNLKIYNSLQTNGTLIDESWAKFLSENKFLVGLSMDGPKEIHNLNRKDCCGLDTFSKVERAAELFKKYKVEF 160
118444880  81 NFVKKYNTRNINVFYSIQTNGTTINEDWAKFFKENNFLVGISLDGTKEIHDKYRLDANKKGSFNKIMTNIKILNRYKVEY 160
110800028 161 NILCVVTSNTARHVNKVYKYFKEKDFKFLQFINCLDPLYEEKGKYNYSLKPKDYTKFLKNLFDFWYEDFLNGNRVSIRYF 240
18309617  161 NILCVVTSNTARHVNKIYRYFKEKDFKFLQFINCLDPLYEEKGKYNYSLKPQDYTKFLKNLFDLWYEDFLNGNRVSIRYF 240
118444880 161 NILTVVNKNTSRHIDKIYKFFKKQDFRFLQFIPCLDPINDPRESHPYSLNPKDYETFLNKLFDLWFKDFLDGRFVSIRYF 240
110800028 241 DGLLETILLGKSSSCGMNGTCTCQFVVESDGSVYPCDFYVLDKWRLGNIQDMTMKELFETNKNHEFIKLSFKVHEECKKC 320
18309617  241 DGLLETILLGKSSSCGMNGTCTCQFVVESDGSVYPCDFYVLDKWRLGNIQDMTMKELFETNKNHEFIKSSFKVHEECKKC 320
118444880 241 DDLLSILLGNNPKSCCMNGFCSCEFVIESDGSVYPCDFYVLDEYKIGYIEEKTFSELFNSNVTKNFIDSSLNHDVKCKNC 320
110800028 321 KWFRLCKGGCRRCRDSKEDSALELNYYCQSYKEFFEYAFPRLINVANNIK 370
18309617  321 KWFKLCKGGCRRCRDSKEDSDLELNYYCQSYKEFFEYAFPRLINVANNIK 370
118444880 321 NWYPLCRSGCRRNKEPNFPNGTNDNIFCESFKSFFEKNISKLTYVAKTLA 370
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap