Conserved Protein Domain Family
PRK13757

?
PRK13757: PRK13757 
type A chloramphenicol O-acetyltransferase
Statistics
?
PSSM-Id: 172295
View PSSM: PRK13757
Aligned: 19 rows
Threshold Bit Score: 396.92
Threshold Setting Gi: 152984367
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
146311189   1 MKTTTLEYTPVDLSRWARKEHFEVFQSFAQSTINQTVLVDITVLLKYIKESGWKFYPTIIFLLSKIVNSHAEFRMAIKNN 80 
134044746   1 MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDG 80 
118614640   1 MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDG 80 
152973805   1 MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDG 80 
38347932    1 MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDG 80 
197284622   1 MDTKRVGYTVVDLSQWGRKEHFEAFQSFAQCTFSQTVQLDITSLLKTVKQNGYKFYPTFIYIISLLVNKHAEFRMAMKDG 80 
213155644   1 MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDG 80 
211909966   1 MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDG 80 
218707880   1 MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDG 80 
260752136   1 MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFLKTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDG 80 
146311189  81 ELVIWNEIHPSYTIFHNETETFSSLWSHYDGNIHHFQDVYSEDVACYGNNLSYWPKeESRENVFFVSAIPWVSFTSFNIN 160
134044746  81 ELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDIACYGENLAYFPK-GFIENMFFVSANPWVSFTSFDLN 159
118614640  81 ELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDIACYGENLAYFPK-GFIENMFFVSANPWVSFTSFDLN 159
152973805  81 ELVIWDSIHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPK-GFIENMFFVSANPWVSFTSFDLN 159
38347932   81 ELVIWDSIHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPK-GFIENMFFVSANPWVSFTSFDLN 159
197284622  81 ELVIWDSVNPGYTIFHEQTETFSSLWSYYHKDINHFLKTYSEDIAQYGDDLAYFPK-EFIENMFFVSANPWVSFTSFNLN 159
213155644  81 ELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPK-GFIENMFFVSANPWVSFTSFDLN 159
211909966  81 ELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPK-GFIENMFFVSANPWVSFTSFDLN 159
218707880  81 ELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPK-GFIENMFFVSANPWVSFTSFDLN 159
260752136  81 ELVIWDSVHPCYTVFHEQTETFSSLWSEYHDDFRQFLHIYSQDVACYGENLAYFPK-GFIENMFFVSANPWVSFTSFDLN 159
146311189 161 VANMQNFFAPMFTIGKYYQQDGKVLLPLAVQVHHSVCDGFHVARLFNELQEMCDDILRLS 220
134044746 160 VANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA 219
118614640 160 VANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA 219
152973805 160 VANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCNEWQGGA 219
38347932  160 VANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCNEWQGGA 219
197284622 160 VANINNFFAPVFTIGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRLLNEIQQYCDE--GCK 217
213155644 160 VANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA 219
211909966 160 VANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA 219
218707880 160 VANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA 219
260752136 160 VANMDNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA 219
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap