Conserved Protein Domain Family
PRK13756

?
PRK13756: PRK13756 
TetR family transcriptional regulator
Statistics
?
PSSM-Id: 172294
View PSSM: PRK13756
Aligned: 31 rows
Threshold Bit Score: 380.392
Threshold Setting Gi: 118601900
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
161598470   1 MAKLDKEQVIDNALILLNEVGIEGLTTRKLAQKIGVEQPTLYWHVKNKRALLDALAETILQKHHHHVLPLPNETWQDFLR 80 
118601900   1 MARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLR 80 
118614633   1 MARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLR 80 
134044775   1 MARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLR 80 
152973825   1 MARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLR 80 
190576845   1 MARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLR 80 
226807692   1 MARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLR 80 
226810003   1 MARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLR 80 
253723685   1 MARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLR 80 
242348154   1 MARLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARHHDYSLPAAGESWQSFLR 80 
161598470  81 NNAKSFRQALLMYRDGGKIHAGTRPSESQFETSEQQLQFLCDAGFSLSQAVYALSSIAHFTLGSVLETQEHQESQKEREK 160
118601900  81 NNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPA 160
118614633  81 NNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPA 160
134044775  81 NNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPA 160
152973825  81 NNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPA 160
190576845  81 NNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPA 160
226807692  81 NNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPA 160
226810003  81 NNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPA 160
253723685  81 NNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPA 160
242348154  81 NNAMSFRRALLRYRDGAKVHLGTRPDEKQYDTVETQLRFMTENGFSLRDGLYAISAVSHFTLGAVLEQQEHTAALTDRPA 160
161598470 161 VETDTVayPPLLTQAVAIMDSDNGDAAFLFVLDVMISGLETVLKSAK 207
118601900 161 APDENL--PPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALL 205
118614633 161 APDENL--PPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALL 205
134044775 161 APDENL--PPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALL 205
152973825 161 APDENL--PPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALL 205
190576845 161 APDENL--PPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALL 205
226807692 161 APDENL--PPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALL 205
226810003 161 APDENL--PPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALL 205
253723685 161 APDENL--PPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALL 205
242348154 161 APDENL--PPLLREALQIMDSDDGEQAFLHGLESLIRGFEVQLTALL 205
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap