Conserved Protein Domain Family
PRK13744

?
PRK13744: PRK13744 
conjugal transfer protein TrbG; Provisional
Statistics
?
PSSM-Id: 139817
View PSSM: PRK13744
Aligned: 18 rows
Threshold Bit Score: 151.054
Threshold Setting Gi: 218692889
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
157418119  1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRSTVFENPDIVKTCTVRDLKKDFVNCDEKG 80 
58000369   1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRNTVFENPDIVKTCTVRDLKNDFVNCDEKG 80 
170650806  1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRNTVFENPDIVKTCTVRDLKNDFVNCDEKG 80 
218534543  1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRSTVFENPDIVKTCTVRDLKKDFVNCDEKG 80 
253801035  1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRSTVFENPDIVKTCTVRDLKKDFVNCDEKG 80 
256367752  1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRNTVFENPDIVKTCTVRDLKNDFVNCDEKG 80 
260751976  1 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRNTVFENPDIVKTCTVRDLKKDFVNCDEKG 80 
268507248  1 MNKLVSDGSVKKINYPVLYESGITPPLYEVSAPEPDAGGKRIVAYVYKSSRNTVFENPDIVKICTVRDLKKDFVNCDEKG 80 
302595402  6 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRNTVFENPDIVKTCTVRDLKNDFVNCDEKG 85 
302595302  6 MNKLVSDGSVKKINYPVLYESGITPPLCEVSAPEPDAGGKRIVAYVYKSSRSTVFENPDIVKTCTVRDLKKDFVNCDEKG 85 
157418119 81 EGQ 83 
58000369  81 EGQ 83 
170650806 81 EGQ 83 
218534543 81 EGQ 83 
253801035 81 EGQ 83 
256367752 81 EGQ 83 
260751976 81 EGQ 83 
268507248 81 EGQ 83 
302595402 86 EGQ 88 
302595302 86 EGQ 88 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap