Conserved Protein Domain Family
PRK13720

?
PRK13720: PRK13720 
modulator of post-segregation killing protein; Provisional
Statistics
?
PSSM-Id: 172262
View PSSM: PRK13720
Aligned: 23 rows
Threshold Bit Score: 106.893
Threshold Setting Gi: 194446874
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
91206342   1 MLRQHQDSLLPRFAQGEEGHETTTQLSCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRIQGGGGFHGLRIR 70 
83404854   1 MSDQHQYGLLPCKLQGGVNHETTGKRPYLVRINRVLHVVDIHTPDPESPVRSPAEGRIQGSYGNNGLRIR 70 
75994535   1 MLRQHQDSLLPRFAQGEEGHETTTQLSCLVCVDSVSHTVDIHLSDTKIAVRDSLQRRIQGGGGFHGLRIR 70 
10955444   1 MLEQHQDSLLPRVTQGEEGHETAEKRPDLVFINRVLHIVNIHVSDPESFVRGPAERRRQGGYGKSGLRIQ 70 
9507778    1 MLRQHQDSLLLRFAQGEEGHETTTQLSCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRIQGGGGFHGLRIR 70 
194446874  1 -------------MQGGVNHETTGKRPYLVRINRVLHVVNIHTPDPESSVRSPAEGRIQGGYGKFGLRIQ 57 
218534528 29 MSDQQQYGLLPCLMQGGVNHETTGKRPYLVRINRVLHVVNIHTPDPESSVRSPAEGRIQGGYGKFGLRIQ 98 
218692905  1 MLRQHQDSLLPRFAQGEEGHETTTQLSCLVCVDRVSHTVDIHLSDTKIAVRDSLQRRIQGGGGFHGLRIR 70 
268507168  1 MSDQQQYGLLPCLMQGGVNHETTGKRPYLVRINRVLHVVNIHTPDPESSVRSPAEGRIQGGYGKFGLRIR 70 
283826871 29 MSDQQQYGLLPCLMQGGVNHETTGKRPYLVRINRVLHVVNIHTPDPESSVRSPAEGRIQGGYGKFGLRIQ 98 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap