Conserved Protein Domain Family
PRK13718

?
PRK13718: PRK13718 
conjugal transfer protein TrbE; Provisional
Statistics
?
PSSM-Id: 172260
View PSSM: PRK13718
Aligned: 39 rows
Threshold Bit Score: 99.4826
Threshold Setting Gi: 17233460
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9507803    2 MKVIFTSNRFIDFLIRLLITAIVISPVIIWSWDTVKETTADGMLAAAFVILYSGVLLFILYFCFSALTDLQKPDERKSDE 81 
152973715  1 MKMSFHKKPVIDFVLRLTLTIIIISPVIYFSWDAVKGTSGSDYVESVVFILMAGFAMSVCYLFFSVLEKVINARKSKDES 80 
17233460   1 -------MKIMSFLVRVVVTLIVISPAVYWSWDAVSTTTADDIMLAVLIIAAYGLMFTLLFCFVNVLTKLLQHDNESS-- 71 
152973581  1 MKMSFHKKPVIDFVLRLTLTIIIISPVIYFSWDAVKGTSGSDYVESVVFILMAGFAMSVCYLFFSVLEKVINARKSKDES 80 
71559049   1 -------MRIIVFLLRLTVTVIVASPAVYWSWDTVKATTAEDSLLAGLIIAANVVMLMPLYCFVLILTKRRQHDNKSS-- 71 
253801043  2 MKVIFTSNRFIDFLIRLLITAIVISPVIIWSWDTVKETTADGMLAAAFVILYSGVLLFILYFCFSALTDLQKPDERKSDE 81 
261888776  1 -------MKIMSFLVRVVVTLIVISPAVYWSWDAVSTTTADDIMLAVLIIAAYGLMFTLLFCFVNVLTKLLQHDNESS-- 71 
305696929  1 -------MKIMSFLVRVVVTLIVISPAVYWSWDAVSTTTADDIMLAVLIIAAYGLMFTLLFCFVNVLTKLLQHDNESS-- 71 
294496790  1 MKMSFHKKPVIDFVLRLTLTIIIISPVIYFSWDAVKGTSGSDYVESVVFILMAGFAMSVCYLFFSVLEKVINARKSKDES 80 
300837066  1 MKMSFHKKPVIDFVLRLTLTIIIISPVIYFSWDAVKGTSGSDYVESVVFILMAGFAMSVCYLFFSVLEKVINARKSKDES 80 
9507803   82 RNED 85 
152973715 81 IYHD 84 
17233460     ----    
152973581 81 IYHD 84 
71559049     ----    
253801043 82 RNED 85 
261888776    ----    
305696929    ----    
294496790 81 IYHD 84 
300837066 81 IYHD 84 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap