Conserved Protein Domain Family
PRK13691

?
PRK13691: PRK13691 
(3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional
Statistics
?
PSSM-Id: 139768
View PSSM: PRK13691
Aligned: 20 rows
Threshold Bit Score: 284.027
Threshold Setting Gi: 148660411
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118467224   1 MALKTDIRGMIWRYPDYFVVGREQLRQFALSVKNRHPAHFSEDAAAELGHDAIIAPLTFATIFAKLVQLDFFRHVDIGME 80 
118616512   1 MALKTDIRGMSWKYPDCFVVGREQVRGFARSVQCDDAACYEEDAAAKLGYGGIVAPMTFVSILAKLVQSDFFRNVDVGME 80 
108797894   1 MALKTDIRGMVWKYPDTFVVGREQIRQYAKSVKVTDPATLDEQAAAELGHDALIAPPTFMSIFAVMIQNHFFQHVDVGLE 80 
120402244   1 MALKTDIRGMVWEYPDVFVVAREQIRQYANSVKAKDPATHDEAAAAELGHSGIIAPPTFMSIFAVMIQNHFFQHVDVGLE 80 
119866989   1 MALKTDIRGMVWKYPDTFVVGREQIRQYAKSVKVTDPATLDEQAAAELGHDALIAPPTFMSIFAVMIQNHFFQHVDVGLE 80 
41410207    1 MALKTDIRGMIWRYPDYFVVGREQLRQFALSVKNRHPAHFSEDAAAELGHDAIIAPLTFATIFAKLVQLDFFRHVDIGME 80 
126433557   1 MALKTDIRGMVWKYPDTFVVGREQIRQYAKSVKVTDPATLDEGAAAELGHDALIAPPTFMSIFAVMIQNHFFQHVDVGLE 80 
145225695   1 MALKTDIRGMVWEYPDVFVVAREQIRQYANAVKAKDPASHDEAAAAELGHGGVVAGPTFMSIFAVMIQNHFFQNVDIGLE 80 
183980990   1 MALKTDIRGMSWKYPDCFVVGREQVRGFARSVQCDDAACYEEDAAAKLGYGGIVAPMTFVSILAKLVQSDFFRNVDVGME 80 
221230499   1 MALKTDIRGMVWRYSDYFIVGREQCREFARAIKCDHPAYFSEDAAAELGYDAIVAPLTFVTIFAKYVQLDFFRNVDVGME 80 
118467224  81 TLVIVQVDQRFVFSKPIKAGDKLWARMDIVSVDERFGADIVVTKNICTNDDGELVLEAYTTLMSQfNGDQSAKLRWDSES 160
118616512  81 TMQIVQVDQRFVFYKPVLAGDKLWARMEVHSVDERFGADIVVTKNVCHNDDGEVVLEAYTTLMGQ-QGDGSAKLKWDKET 159
108797894  81 TLQIVQVDQKFLFHRPIVAGDSLTGTMYIETVDERFGADIVTTRNVLTDSTGAVVMESFTTLMGH-EGDNSISAKWDPET 159
120402244  81 TLQIVQVDQRFLFHRPIKDGDRLRGALTILTVDERFGADIVTTRNVLTDDAGEIVMESFTTLMGH-EGDNSISAGWDPET 159
119866989  81 TLQIVQVDQKFLFHRPIVAGDSLTGTMYIETVDERFGADIVTTRNVLTDSTGAVVMESFTTLMGH-EGDNSISAKWDPET 159
41410207   81 TLVIVQVDQRFVFSKPIKAGDKLWARMDIVSVDERFGADIVVTKNICTNDDGELVLEAYTTLMSQfNGDQSAKLRWDSES 160
126433557  81 TLQIVQVDQKFLFHRPIVAGDALTGTMYIETVDERFGADIVTTRNVLTDPTGAVVMESFTTLMGH-EGDNSISAKWDPET 159
145225695  81 TMQIVQVDQKFLFHRPIKDGDRLRGVMTILTVDERFGADIVTTRNVLTDDAGEVVMESFTTLMGH-EGDNSISAGWDPET 159
183980990  81 TMQIVQVDQRFVFYKPVLAGDKLWARMEVHSVDERFGADIVVTKNVCHNDDGEVVLEAYTTLMGQ-QGDGSAKLKWDKET 159
221230499  81 TMQIVQVDQRFVFHKPVLVGDKLWARMDIHSVSERFGADIVVTKNSCTSDDGELVMEAYTTLMGQ-QGDNSSQLKWDKES 159
118467224 161 GQVVRTA 167
118616512 160 GQVIRTA 166
108797894 160 GQVVRTA 166
120402244 160 GQVLRKP 166
119866989 160 GQVVRTA 166
41410207  161 GQVVRTA 167
126433557 160 GQVVRTA 166
145225695 160 GQVVRKP 166
183980990 160 GQVIRTA 166
221230499 160 GQVIRSA 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap