Conserved Protein Domain Family
cbiO

?
PRK13652: cbiO 
cobalt transporter ATP-binding subunit; Provisional
Statistics
?
PSSM-Id: 172200
View PSSM: PRK13652
Aligned: 4 rows
Threshold Bit Score: 507.033
Threshold Setting Gi: 219851683
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124486208   1 MHLIETRDLCYSYSTSKEpVLNNINFIAGRKQRIAVLGPNGAGKSTLFRHLNGILKPKSGSVLIRGEPITKANIHEVRKF 80 
88602753    1 MHIIETQDLCHTYKGNID-ALKNISFIAPRNTRIAIIGPNGAGKSTLFKHFNGVLKPTSGKVLIRGEPITKENIREVRRT 79 
126179350   1 MHLLETRDLTHIYRGDVH-ALEGVNFTAERKSRIAVIGPNGAGKSTLFKHFNGILKPTSGEVLVRGEPITKENVREVRKF 79 
219851683   1 MHLIETRNLSYQYTSSRK-ALDGVNFFAPRNSRIAVIGSNGAGKSTLFRHFNGILTPSSGQVLVRGEQITKKNLKEIRKF 79 
124486208  81 VGLVFQNPDDQVFSTTVEQDIAFGPCNLGLDEETIAHRVDSVVHMLGLEDLRDRAPHHLSGGEKKRVAIAGVLAMEPQVL 160
88602753   80 VGLVFQNPDDQIFSPTVEQDVAFGPINMGLDEEAVKHRVSEALRTVGLSEYRTRVPHHLSGGEKKRVAIAGIIAMEPQVL 159
126179350  80 VGIVFQNPDDQIFSPTVEQDIAFGPINLGLDEATVAHRVEEALHLLGIEELRERVPHHLSGGEKKRVAIAGILAMEPQVL 159
219851683  80 VGLVFQNSDDQIFSPTVEQDIAFGPTNLGLDTETVEHRVSSALKMLGIEHLLDRVPHHLSGGEKKRVAIAGVIAMEPEVL 159
124486208 161 ILDEPTAGLDPLGVKELFDFLNALPETYGFTVIYSTHQVELVPEMADYVYVMEKGEITGYGTPQEIFLQDDLLARAHLEL 240
88602753  160 VLDEPTAGLDPQGVREIIRFIRDFSVRYGMTVIFSTHNISLVAELAEYIYVMNNGSFVAEGTVAEIFSQPDLLSSVRLDL 239
126179350 160 VLDEPTAGLDPQGVADLVAFVNRLPEEYGMTVVFSTHHLDLVAEMADYIYVMDKGRVVGSGTVEEVFTRPELLTQTRLDV 239
219851683 160 VMDEPTAGLDPEGRDDLILFMNDLVKTYGMTVVFSTHELDLIPSMADYIYVMDKGRICAQGTVEEIFLQEDLLRRVHLTM 239
124486208 241 PSLPRLIQALQAQGINIESAYTYQDAEDAFMKAFGKEP 278
88602753  240 PILPKLISSLRSKGIAIDMGYTYQEAEIAFLKAFGKIA 277
126179350 240 PPIPKLIRSLRENGVAIDMAYTYEDAKKSFLDAYARRA 277
219851683 240 PVLPKLIRTLQNQGIEISMAYTYEEAEAAFLEAFNGRA 277
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap