Conserved Protein Domain Family
psbV

?
PRK13620: psbV 
cytochrome c-550; Provisional
Statistics
?
PSSM-Id: 139707
View PSSM: PRK13620
Aligned: 2 rows
Threshold Bit Score: 447.636
Threshold Setting Gi: 56752094
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
81300819   1 MVNIEDGFGCLWLLQIILPCSQTASTSSSHWAGESRPFRELVRSSSPSMVFKTLRRTLWLTLAALLAVFQFNLGAAQAAE 80 
56752094   1 MVNIEDGFGCLWLLQIILPCSQTASTSSSHWAGESCPLRELVRSSSPSMVFKTLRRTLWLTLAALLAVFQFNLGAAQAAE 80 
81300819  81 LTAETRTVKLNPQGDNVTLSLKQVAEGKQLFAYACGQCHVGGITKTDPNVGLDPEALALATPPRDSVESLVDYLHNPTTY 160
56752094  81 LTAETRTVKLNPQGDNVTLSLKQVAEGKQLFAYACGQCHVGGITKTDPNVGLDPEALALATPPRDSVESLVDYLHNPTTY 160
81300819 161 DGEREISELHPSTKSTDIFPKMRNLTEDDLVAISGHILLQPKIVGTKWGGGKIYY 215
56752094 161 DGEREISELHPSTKSTDIFPKMRNLTEDDLVAISGHILLQPKIVGTKWGGGKIYY 215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap