Conserved Protein Domain Family
psbV

?
PRK13619: psbV 
cytochrome c-550; Provisional
Statistics
?
PSSM-Id: 172177
View PSSM: PRK13619
Aligned: 6 rows
Threshold Bit Score: 311.373
Threshold Setting Gi: 166363923
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16331106    1 MKRFFLVAIASVLFFFNTMVGSANAVELTESTRTIPLDEAGGTTTLTARQFTNGQKIFVDTCTQCHLQGKTKTNNNVSLG 80 
166363923   2 IKRLIVAAIAVVFFVLQFNLNGASALELNEKTLTITLNDAGESVTLTSEQATEGQKLFVANCTKCHLQGKTKTNNNVSLG 81 
172037868   2 VKRFILMAIAAIFFFLQFPIHNANALELTEETRTVPLNEEGETITLTSEQITNGQRLFIRECTQCHLQGKTKTNNNVSLG 81 
218440050   2 VKRFVWVAIATVFFIFQLHVNSASALELDKDTLTIPLNEGGDTTTLTSKQATNGQRLFNLECTQCHLQGKTKTNNNVSLG 81 
218249017   1 MKRFILLAIATVFFFCQFQTNPVNALELDEATRTVALDETGKTTIVTSKQITNGQRLFVQECTQCHLQGKTKTNNNVSLG 80 
257062103   1 MKRFILLAIATVFFFCQFQTNPVNALELDEATRTVALDETGKTTIVTSKQITNGQRLFVQECTQCHLQGKTKTNNNVSLG 80 
16331106   81 LADLAGAEPRRDNVLALVEFLKNPKSYDGEDDYSELHPNISRPDIYPEMRNYTEDDIFDVAGYTLIAPKLDERWGGTIYF 160
166363923  82 LGDLAKAEPPRDNLLALIDYLEHPTSYDGEDDLSELHPNVSRPDIFPELRNLTEDDVYNVAAYMLVAPRLDERWGGTIYF 161
172037868  82 LEDLSLAEPPRDNVLGLVDYLKYPTSYDGEDDYTELHVNVSRPDIYPELRDFTEDDLYDVSGYILVAPKLDSYWGGSIYF 161
218440050  82 LEDLSKADPRRDNVLALVDYLKNPTSYDGEDDYTELHPNVSRPDLFPELKNFTEDDVFDVAGYMLIAPKLDTRWGGTIYF 161
218249017  81 LDDLAGAEPPRNNVLALVDYLKHPTSYDGEDNYEELHVNVTRPDLFPELRNFTEDDLYDVAGYVLVAPKLDAYWGGSIYF 160
257062103  81 LDDLAGAEPPRNNVLALVDYLKHPTSYDGEDNYEELHVNVTRPDLFPELRNFTEDDLYDVAGYVLVAPKLDAYWGGSIYF 160
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap