Conserved Protein Domain Family
psbV

?
PRK13617: psbV 
cytochrome c-550; Provisional
Statistics
?
PSSM-Id: 106562
View PSSM: PRK13617
Aligned: 8 rows
Threshold Bit Score: 303.312
Threshold Setting Gi: 148242939
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148242939  11 LPHSMRTVLQGLRRLGALLLLPIALLLLAPaAHAVQWDAETLTVPADASGSTVTFTESEIKAGRKVFNNSCGECHAGGIT 90 
113952941  13 MASFFSTLRRSLNRLLIALPVLLGLMISTP-AQAAQWDAETLTVPADGDGALVTFSEQEIKTGRKVFNVSCGTCHAGGIT 91 
78184108    1 MVSVFSSLRQSFKGLLVLVPVLIGLAFISP-AEAVQWDAETLTVPVNPDGAEVTFTDREINAGRKVFNTSCGTCHAGGIT 79 
148240313   1 MASFLPNVRRSLSRLLIVLSAFAVLVIGTP-AQAASWDAETLTVPADAEGSPVTFSEQQVKAGRKVFNTSCGTCHAGGIT 79 
124022241   1 MASLFASLGRSLIKLLIVLPVIIGLSISSP-AMAAQWDAETLTVPAGSGGQQVTFSESEIKSASKLFKSNCATCHNQGVT 79 
78213661   17 MASVFSSLRRSLKGLLVLIPVLIGLAVTSP-AQAAQWDAETLTVPADPSGTEVTFSDREIDSGRKVFNTSCGTCHAGGIT 95 
33863694    1 MASLFASLGRSLIKLLIVLPVIIGLSISSP-AMAAQWDAETLTVPAGSGGQQVTFTESEIKSASKLFKSNCATCHNQGVT 79 
33865073   12 MASLFSTLQRSLKGLLILVPVLIGLVLASP-AEAVRWDAETLTVPGNPEGTQVTFSEQEINTGRKVFNTSCGTCHAGGIT 90 
148242939  91 KTNQNVGLDPETLALATPPRDSVDALVDYMKDPTSYDGEISIAEFHPSMRSADVFVKMRDLNDEDLRRMAGYILTSPKAQ 170
113952941  92 KTNQNVGLDTETLALATPARDNVASLVDYLQDPTSYDGEYSIADLHPSMRSRDLYPAMRDLTDEDLRLMSGYILVAPKVL 171
78184108   80 KTNQNVGLDPETLALATPARDNVDALVDYMKDPTSYDGEYSISDVHPSMRSAELYPAMRDLDDEDLRLMAGYILVSPKVQ 159
148240313  80 KTNHNVGLDPETLALATPARDNVAALVDYLQDPTSYDGEYSIADLHPSMRSRDLYPAMRDLTDEDLRLMSAYILVAPKVL 159
124022241  80 KTNQNVGLDLEALSLASPARDNVDGLVEFLKNPMSYDGEYSIADTHPGISSSDVYVQMRTLNDEDLRLIAGYILTAEKVQ 159
78213661   96 KTNHNVGLDPETLALATPARDNVEALVDYMKDPTSYDGEYSIADLHPSMRDAELYPAMRDLDDEDLRLMAGYILVSPKVQ 175
33863694   80 KTNQNVGLDLEALSLASPARDNVDGLVEFLKNPMSYDGEYSIADTHPGISSSDVYVQMRTLNDEDLRLIAGYILTAEKVQ 159
33865073   91 KTNQNVGLDPETLALATPARDNVDALVDYMKDPTSYDGEYSIADLHPSMRDAELYPAMRDLTDEELRLMAGYILVAPKVQ 170
148242939 171 GTQWGGGKIYF 181
113952941 172 GVDWGGGKIYF 182
78184108  160 GSSWGGGKIYF 170
148240313 160 GQEWGGGKIYF 170
124022241 160 GDQWGGGKIYF 170
78213661  176 GSAWGGGKIYF 186
33863694  160 GDQWGGGKIYF 170
33865073  171 GTAWGGGKIYF 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap