Conserved Protein Domain Family
PRK13610

?
PRK13610: PRK13610 
photosystem II reaction center protein Psb28; Provisional
Statistics
?
PSSM-Id: 139699
View PSSM: PRK13610
Aligned: 2 rows
Threshold Bit Score: 195.739
Threshold Setting Gi: 124025474
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
72381975    1 MTKINENVAIQFVKGENEKDQPEIRLFRNLDGKKGKAVYKFYKPKTITLTNYKSVQRMFLIDSEGVLSTKKIDLSISEDH 80 
124025474   1 MTKINENVAIQFVKGENEKDQPEIRLFRNLDGKNGKAVYKFYKPTTITLTNYKSVQRMFLIDSEGVLSTKKIDLSISEDH 80 
72381975   81 VKEVKSTYNWNSEEEFERFMRFASRYANSLSQN 113
124025474  81 VKEVKSTYSWNSEEAFERFMRFASRYANSLSKN 113
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap