Conserved Protein Domain Family
PRK13603

?
PRK13603: PRK13603 
fumarate reductase subunit C; Provisional
Statistics
?
PSSM-Id: 172166
View PSSM: PRK13603
Aligned: 5 rows
Threshold Bit Score: 181.401
Threshold Setting Gi: 148822777
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148661350   1 MSAYRQPVERYWWARRRSYLRFMLREISCIFVAWFVLYLMLVLRAVGAGGNSYQRFLDFSANPVVVVLNVVALSFLLLHA 80 
148822777   1 MSAYRQPVERYWWARRRSYLRFMLREISCIFVAWFVLYLVLVLRAVGAGGNSYQRFLDFSANPVVVVLNVVALSFLLLHA 80 
15841021    1 MSAYRQPVERYWWARRRSYLRFMLREISCIFVAWFVLYLVLVLRAVGAGGNSYQRFLDFSANPVVVVLNVVALSFLLLHA 80 
15608692    1 MSAYRQPVERYWWARRRSYLRFMLREISCIFVAWFVLYLMLVLRAVGAGGNSYQRFLDFSANPVVVVLNVVALSFLLLHA 80 
253799392   1 MSAYRQPVERYWWARRRSYLRFMLREISCIFVAWFVLYLVLVLRAVGAGGNSYQRFLDFSANPVVVVLNVVALSFLLLHA 80 
148661350  81 VTWFGSAPRAMVIQVRGRRVPARAVLAGHYAAWLVVSVIVAWMVLS 126
148822777  81 VTWFGSAPRAMVIQVRGRRVPARAVLAGHYAAWLVVSVIVAWMVLS 126
15841021   81 VTWFGSAPRAMVIQVRGRRVPARAVLAGHYAAWLVVSVIVAWMVLS 126
15608692   81 VTWFGSAPRAMVIQVRGRRVPARAVLAGHYAAWLVVSVIVAWMVLS 126
253799392  81 VTWFGSAPRAMVIQVRGRRVPARAVLAGHYAAWLVVSVIVAWMVLS 126
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap