Conserved Protein Domain Family
ubiA

?
PRK13595: ubiA 
prenyltransferase; Provisional
Links
?
Statistics
?
PSSM-Id: 172161
View PSSM: PRK13595
Aligned: 5 rows
Threshold Bit Score: 332.595
Threshold Setting Gi: 94984955
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15805835   39 MSAAPPRLLLPLSRLLVISRPALWVNTIGTLVTGVWLTGRLYTLDGGVLALLLYLTLPFNLLIYGLNDLADREEDARSSR 118
94984955    1 MRPLTLPARLPLRRMLAVSRPALWVNTVGTLVTGLWLSGHLLTLQPGVLLLLVYLTLPFNLLIYGLNDLADREEDALSAR 80 
108805023   1 -------MCAVLSRLLHISRPVLWINTVGSGFVGMWLAGHLWSW--GFLPLALWLTLPFNLLIYGTNDIFDQETDAANPR 71 
170781379   9 SRIAPSGIGVAMRRLVLISRPVLWINTIGSGLVAVWLTGALFDM--RALPLILWLTLPFNLLIYGVNDIYDQDTDAANPR 86 
226356343   1 MPNPALFPLLPFHRLLTVSRPALWVNTVGTLVTGLWLTGHLYRLDASLLLLLVYLTLPFNLLIYGLNDLSDREVDARSSR 80 
15805835  119 KGGWQGARLRPEEEGPLRRSTLLLNAPLLLGLAMWLPPAATATLLLAAALFVGYSLPPLRFKARPFLDGLSNVAYALPLA 198
94984955   81 KGGWQGARLSLGEGGPLLAAILALNAPFLLALALLLPPAASLLLLLAVALFAAYSLPPLRLKGRPFLDGLSNMAYALPLA 160
108805023  72 KGSLEGARISPGEVRTIWRAVLLSNAPFAAYFALALPPAAALWVAAYALVFLGYSVPPVRFKARPYLDSLSNAAYAFPLV 151
170781379  87 KGSIEGARIRPSEVRLIAWAVATVNVPFLVYFLLVLPPLANAAILLYAGVFVFYSAPPLRFKARPFLDSLSNAAYALPLV 166
226356343  81 KGGWQGARLTPGEARPLLRSTLLLNVPFLLALALLLPLKATLLLLGSAVLFAAYSLPPLRLKARPFLDGLSNVAYALPLA 160
15805835  199 LPALALGAPVPWAPLLALMSYSVGKHAFDAAQDIPADRAAGTRTVATTLGTRGVAAYALAWFTLAGALLWPVSRLTALAL 278
94984955  161 LPALALGAPVPGLPLAALMAFSVGKHAFDAAQDISADRLAGTRTVATTLGVRGTALYALAWFLLAGALLWPLSRLTAAAL 240
108805023 152 FVPLALGESPVWPAALGLMAWSVAKHAFDAVQDIREDRRAGILTTPVRLGVRGTVLWSGAWWALATLLFAAVSPPVALLN 231
170781379 167 IVPAALGVAPVWPAVLGLMAWSVAKHAFDAVQDIVEDREAGITTSAVRLGSRGTALWSGAWWILSAALFAVVSVPVAAVD 246
226356343 161 LPALVLGAPVPWAPLLALMAYSVGKHAFDAAQDIPADRAAGTRTVATTLGVQGTARYALFWFLLAGACLWPVSRLTALAL 240
15805835  279 WLTCGGMALALLRRPAPEQAGRLYPLSIVTPWIVGSVAGVQLVYLLARGQWD 330
94984955  241 WAVCGGMALSLWRHPTPERAARLYPLSIVTPWIVGTVAGVPLVYLLARGLWP 292
108805023 232 AAIAASLLLALWRRPHPGTGHRLYRYSIAFPYVAGTASGVLLVAALSLGAYP 283
170781379 247 LLIAGILVVRLLRDPRPETGHRLYRLSVAFPYIAGTLPGVLLMVAIVFGGYP 298
226356343 241 WLTCAGMALALHIRPTLQQASRLYPLSIVTPWIVGAVAGVQLVAGLVRGS-- 290
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap