Conserved Protein Domain Family
ubiA

?
PRK13592: ubiA 
prenyltransferase; Provisional
Statistics
?
PSSM-Id: 139690
View PSSM: PRK13592
Aligned: 3 rows
Threshold Bit Score: 396.915
Threshold Setting Gi: 157150684
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
125717848   1 MFKRLAVYYKEMFPLLPRFFVAAIMFFEIYFVLLLNDGVTTFHFDHQELIGIFTIFVFLMILRIADDFKDYETDRRLFPH 80 
15894087    1 MIKRLNVYLKEMYPLLPRLILSLTLFFEIYMITLLSNHISSFRIGIQEFVGVFTVFGFWLALRIADELKDYETDKINFPK 80 
157150684   1 -----------------------------------------------------------MILRIADDFKDYETDRRLFPH 21 
125717848  81 RALPSGRVKKKDLAIALSFIVAVSVLLNVLFMNNIGWFLFLYIYGTLMSFWFFKRDKIQNSLPLALVTHNPVMMILNLYT 160
15894087   81 RPLPSGRVTKRDLWILLTIDYALMIFLNLVFMNNVLFFIVLLIYGVLMSLWFFAKKYIQPNLVLALITHNPVELILDYYI 160
157150684  22 RALPSGRVKKKDLAIALSFIVAVSVLLNVLFMNNVGWFLFLYIYGTLMSFWFFKRDKIQNSLPLALVTHNPVMMILNLYT 101
125717848 161 ISFVCYKYNLPLLSLPTVLLAFTMYFPSLIWEVCRKIRAPKDETEYVTYSKLFGYKKATRFIEVVTLLDILTNFALLWNI 240
15894087  161 ISFACIKYKLPVFTGTTLLICVTLYFPALAWEVSRKIKAPDDENQYVTYSKLFGYKKATMFVMLVIFCEMITTNILAYRL 240
157150684 102 ISFVCYKYNLPLLSLPTVLLAFTMYFPSLIWEVCRKIRAPKDETEYVTYSMLFGYKKATRFIEVVTLLDILTNFALLWNI 181
125717848 241 SHVGVVVLVLNVIWMTVQFEQFIKDPTRFNIRERVERYTYITETTMVLSVAVYLLmgVL 299
15894087  241 SIIMVIILTVRYFWLVYNCIEFIKSPKKFKLGKRVEVYLYITALLVLIMEILNLF--VM 297
157150684 182 SHVGVVVLVLNVIWMTVQFEQFIKNPTRFNIRERVERYTYITETTMVLSVAVYLLmgVL 240
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap