Conserved Protein Domain Family
PRK13589

?
PRK13589: PRK13589 
flagellin A
Statistics
?
PSSM-Id: 172158
View PSSM: PRK13589
Aligned: 5 rows
Threshold Bit Score: 875.509
Threshold Setting Gi: 222823204
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
121612455   1 MGFRINTNIGALNAHANSVVNSNELDKSLSRLSSGLRINSAADDASGMAIADSLRSQAATLGQAINNGNDAIGILQTADK 80 
57238729    1 MGFRINTNIGALNAHANSVVNARELDKSLSRLSSGLRINSAADDASGMAIADSLRSQAATLGQAINNGNDAIGILQTADK 80 
157415575   1 MGFRINTNIGALNAHANSVVNSNELDKSLSRLSSGLRINSAADDASGMAIADSLRSQAATLGQAINNGNDAIGILQTADK 80 
218562947   1 MGFRINTNIGALNAHANSVVNARELDKSLSRLSSGLRINSAADDASGMAIADSLRSQAATLGQAINNGNDAIGILQTADK 80 
222823204   1 MGFRINTNVASLNAQANANLNSRALDTSLSRLSSGLRINSAADDASGMAIADSLRSQASTLGQAINNGNDALGILQTADK 80 
121612455  81 AMDEQLKILDTIKTKATQAAQDGQSLKTRTMLQADINKLMEELDNIANTTSFNGKQLLSGNFTNQEFQIGASSNQTVKAT 160
57238729   81 AMDEQLKILDTIKTKATQAAQDGQSLKTRTMLQADINRLMEELDNIANTTSFNGKQLLSGNFINQEFQIGASSNQTVKAT 160
157415575  81 AMDEQLKILDTIKTKATQAAQDGQSLKTRTMLQADINRLMEELDNIANTTSFNGKQLLSGNFTNQEFQIGASSNQTIKAT 160
218562947  81 AMDEQLKILDTIKTKATQAAQDGQSLKTRTMLQADINRLMEELDNIANTTSFNGKQLLSGNFINQEFQIGASSNQTIKAT 160
222823204  81 AMDEQLKILDTIKVKATQAAQDGQSTKTRNMLQADINRLMEELDNIANTTAFNGKQLLSGGFTNQEFQIGAQSNQSIKAT 160
121612455 161 IGATQSSKIGVTRFETGAQSFTSGVVGLTIKNYNGIEDFKFDNVVISTSVGTGLGALAEEINKSADKTGVRATYDVKTTG 240
57238729  161 IGATQSSKIGLTRFETGGRITSGGEVQFTLKNYNGIDDFQFQKVVISTSVGTGLGALAEEINKSADKTGVRATFTVETRG 240
157415575 161 IGATQSSKIGVTRFETGAQSFTSGVVGLTIKNYNGIEDFKFDNVVISTSVGTGLGALAEEINKSADKTGVRATYDVKTTG 240
218562947 161 IGATQSSKIGLTRFETGGRISSSGEVQFTLKNYNGIDDFQFQKVVISTSVGTGLGALAEEINKSADKTGVRATFTVETRG 240
222823204 161 IGATQSSKIGVTRFETGSMSNTSGIAQLTIKNYNGIDDFKFQPVVISTSVGTGMGALAEEINRVADVTGVRANFLVETTG 240
121612455 241 VYAIKEGTTSQDFAINGVVIGQINYKDGDNNGQLVSAINAVKDTTGVQASKDENGKLVLTSADGRGIKITGDIGVGSGIL 320
57238729  241 MAAVRAGTTSNDFAINGVTIGQVAYEDGDGNGALVAAINSVKDTTGVEASIDANGQLLLTSREGRGIKIDGNIGGGAFIN 320
157415575 241 VYAIKEGTTSQDFAINGVVIGQINYKDGDNNGQLVSAINAVKDTTGVQASKDENGKLVLTSADGRGIKITGDIGVGSGIL 320
218562947 241 IAAVRAGTTSDTFAINGVTIGQVAYEDGDGNGALVAAINSVKDTTGVEASIDANGQLLLTSREGRGIKIDGNIGGGAFIN 320
222823204 241 VGAIKADKTSQDFTINGVRIGEVEYKDGDENGALISAINSVKDTTGVEASKDANGRLVLNSRDGRGIKIEGSMGMGAGVL 320
121612455 321 ANQKENYGRLSLVKNDGRDINISGTNLSAIGMGTTDMISQSSVSLRESKGQISATNADAMGFNSYKGGgkfVFTQNVSSI 400
57238729  321 ANMKENYGRLSLVKNDGKDILVSGTGLSFAGFGANSFISQASISLRESKGRFDANIADAMGFGSVNKG---VVIGGFSTV 397
157415575 321 ANQKENYGRLSLVKNDGRDINISGTNLSAIGMGTTDMISQSSVSLRESKGQISATNADAMGFNSYKGGgkfVFTQNVSSI 400
218562947 321 ADMKENYGRLSLVKNDGKDILISGSNLSSAGFGATQFISQASVSLRESKGRFDANIADAMGFGSANKG---VVLGGYSSV 397
222823204 321 KADYENYGRLSLVKNDGKDIAISGSNLSTIGMGAGDMISQASISLRESKGNIDTNVADAMGFNAYKGGgkmIVT--FSSV 398
121612455 401 SAFMSAQGSGFSRGSGFSVGSGKNLSVGLSQGIQIISSAASMSNTYVVSAGSGFSSGSGNSQFAALKTTA-ANTTDETAG 479
57238729  398 SAYMSSEGSGFSAGSGYSIGSGKGYSATLTGNATFISTASAASRVYNVSSGSGFSTGSNLSQFATMKTSV-LGVKDETAG 476
157415575 401 SAFMSAQGSGFSRGSGFSVGSGKNLSVGLSQGIQIISSAASMSNTYVVSAGSGFSSGSGNSQFAALKTTA-ANTTDETAG 479
218562947 398 SAYMSSAGSGFSSGSGYSVGSGKNYSTGFANAIAI-SAASQLSTVYNVSAGSGFSSGSTLSQFATMKTTA-FGVKDETAG 475
222823204 399 SSFMNSEGSGMSQGSGYSVGSGKNMSLVYNS-----TEALAFVTAFSIAFGTG-SSANGASQFANFVASAnIAAKDQQAG 472
121612455 480 VTTLKGAMAVMDIAETAITNLDQIRADIGSVQNQLQVTINNITVTQVNVKAAESTIRDVDFASESANFSKYNILAQSGSY 559
57238729  477 VTTLKGAMAVMDIAETATTNLDQIRADIGSVQNQLQVTINNITVTQVNVKAAESTIRDVDFAAESANFSKYNILAQSGSY 556
157415575 480 VTTLKGAMAVMDIAETAITNLDQIRADIGSVQNQLQVTINNITVTQVNVKAAESTIRDVDFASESANFSKYNILAQSGSY 559
218562947 476 VTTLKGAMAVMDIAETATTNLDQIRADIGSVQNQLQVTINNITVTQVNVKAAESTIRDVDFAAESANFSKYNILAQSGSY 555
222823204 473 VTTLKGAMAVMDIAETAITNLDQIRADLGAVQNQITATLNNISVTQVNIKSAESNIRDVDFAAESANFAKFNILAQSGSY 552
121612455 560 AMSQANAVQQNVLKLLQ 576
57238729  557 AMSQANAVQQNVLKLLQ 573
157415575 560 AMSQANAVQQNVLKLLQ 576
218562947 556 AMSQANAVQQNVLKLLQ 572
222823204 553 AMSQANAVQQNVMRLLQ 569
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap