Conserved Protein Domain Family
PRK13587

?
PRK13587: PRK13587 
1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional
Statistics
?
PSSM-Id: 172156
View PSSM: PRK13587
Aligned: 19 rows
Threshold Bit Score: 429.636
Threshold Setting Gi: 224476122
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57651066    1 MIELWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECVNRIHIVDLIGAKAQHAREFDYIKSLRRLTTKDIE 80 
57865753    1 MIDLWPAIDLINSTSVRLTEGKYDSKEKMEKSVEDSIRFYSQFKCVKRIHIVDLIGAKAKEVKEFDYIRSLRKLTTKPIE 80 
88196627    1 MIELWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECVNRIHIVDLIGAKAQHAREFDYIKSLRRLTTKDIE 80 
82752253    1 MIELWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECVNRIHIVDLIGAKAQHAREFDYIKSLRRLTTKDIE 80 
21284322    1 MIELWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECVNRIHIVDLIGAKAQHAREFDYIKSLRRLTTKDIE 80 
151222784   1 MIELWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECVNRIHIVDLIGAKAQHAREFDYIKSLRRLTTKDIE 80 
161510881   1 MIELWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECVNRIHIVDLIGAKAQHAREFDYIKSLRRLTTKDIE 80 
49484869    1 MIELWPAIDLIGSTSVRLTEGKYDSEEKMSRSAEESIAYYSQFECVNRIHIVDLIGAKAQHAREFDYIKSLRRLTTKDIE 80 
73661734    1 MIKLWPAIDLINATSVRLTEGKYDSEVKMARSAEESVLFYNQYQCVDRIHIVDLIGAKNQVSIESDYINQLRSLTDKPME 80 
27467193    1 MIDLWPAIDLINSTSVRLTEGKYDTKEKMEKSVEDSIRFYSQFKCVKRIHIVDLIGAKAKEVKEFDYIRSLRKVTTKPIE 80 
57651066   81 VGGGIRTKSQIMDYFAAGINYCIVGTKGIQDTDWLKEMAHTFPGRIYLSVDAYGEDIKVNGWEEDTELNLFSFVRRLSDI 160
57865753   81 VGGGIRSKQTIENYIHSGIDYCIVGTKGIQDIEWLTHMTHQFPNKLYLSVDAFGEKIKINGWKEDAKLNLFDYVAKIEHL 160
88196627   81 VGGGIRTKSQIMDYFAAGINYCIVGTKGIQDTDWLKEMAHTFPGRIYLSVDAYGEDIKVNGWEEDTELNLFSFVRRLSDI 160
82752253   81 VGGGIRTKSQIMDYFAAGINYCIVGTKGIQDTDWLKEMAHTFPGRIYFSVDAYGEDIKVNGWEEDTELNLFSFVKQLSDI 160
21284322   81 VGGGIRTKSQIMDYFAAGINYCIVGTKGIQDTDWLKEMAHTFPGRIYLSVDAYGEDIKVNGWEEDTELNLFSFVRRLSDI 160
151222784  81 VGGGIRTKSQIMDYFAAGINYCIVGTKGIQDTDWLKEMAHTFPGRIYLSVDAYGEDIKVNGWEEDTELNLFSFVRRLSDI 160
161510881  81 VGGGIRTKSQIMDYFAAGINYCIVGTKGIQDTDWLKEMAHTFPGRIYLSVDAYGEDIKVNGWEEDTELNLFSFVRRLSDI 160
49484869   81 VGGGIRTKSQIMDYFAAGINYCIVGTKGIQDTEWLKEMAHTFPGRIYLSVDAYGEDIKVNGWEEDTELNLFSFVKQLSDI 160
73661734   81 VGGGIRDRNTIDTYFNNGIDYCIIGTKGIEDLAWLSHMTQAFPNRLYLSIDAYRRQVKINGWEEDAGLDIFDLLQQVESL 160
27467193   81 VGGGIRSKQTIENYIHSGIDYCIVGTKGIQDIEWLTHMTHQFPNKLYLSVDAFGEKIKINGWKEDAKLNLFDYVAKIEHL 160
57651066  161 PLGGIIYTDIAKDGKMSGPNFELTGQLVKATTIPVIASGGIRHQQDIQRLASLNVHAAIIGKAAHQASFWEGLK 234
57865753  161 PLGGVIYTDISKDGKLSGPNFDLTGRLALYTSLPVIASGGIRHQEDLFRLESLNVHAAIVGKAAHLDEFWEGLS 234
88196627  161 PLGGIIYTDIAKDGKMSGPNFELTGQLVKATTIPVIASGGIRHQQDIQRLASLNVHAAIIGKAAHQASFWEGLK 234
82752253  161 PLGGIIYTHIAKDGKMSGPNFELTGQLVKATTIPVIASGGIRHQQDIQRLASLNVHAAIIGKAAHQASFWEGLK 234
21284322  161 PLGGIIYTDIAKDGKMSGPNFELTGQLVKATTIPVIASGGIRHQQDIQRLASLNVHAAIIGKAAHQASFWEGLK 234
151222784 161 PLGGIIYTDIAKDGKMSGPNFELTGQLVKATTIPVIASGGIRHQQDIQRLASLNVHAAIIGKAAHQASFWEGLK 234
161510881 161 PLGGIIYTDIAKDGKMSGPNFELTGQLVKATTIPVIASGGIRHQQDIQRLASLNVHAAIIGKAAHQASFWEGLK 234
49484869  161 PIGGIIYTDIAKDGKMSGPNFELTGQLVKATTIPVIASGGIRHQQDIQRLASLNVHAAIIGKAAHQASFWEGLK 234
73661734  161 PLGGIIYTDISKDGKLEGPNFEITQQLVQATQKPIIASGGIRHQQDLAQLESIGVHAAIVGKAAHNATFWEGLS 234
27467193  161 PLGGVIYTDISKDGKLSGPNFDLTGRLALYTSLPVIASGGIRHQEDLFRLESLNVHAAIVGKAAHLDEFWEGLS 234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap