Conserved Protein Domain Family
hisG

?
PRK13584: hisG 
ATP phosphoribosyltransferase
Statistics
?
PSSM-Id: 172153
View PSSM: PRK13584
Aligned: 19 rows
Threshold Bit Score: 348.749
Threshold Setting Gi: 57865757
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224476127   1 MLTVALSKGRLLKDFIKFLERNNNHVWADAIIHRERKLQITADSIKFILVKGSDVPTYVEEGIADIGITGSDILKERpNR 80 
87162093    1 MLRIAIAKGRLMDSLINYLDVIEYTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVEQGMADIGIVGSDILDER-QY 79 
27467189    1 MLRVALAKGRLLKSFIEYLQQVNQIDIATVLLNRQRQLLLTVDNIEMILVKGSDVPTYVEQGIADVGIVGSDILNGQ-KY 79 
161510886   1 MLRIAIAKGRLMDSLINYLDVIEYTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVEQGMADIGIVGSDILDER-QY 79 
57865757    1 MLRVALAKGRLLKSFIEYLQQVNQIDIATVLLNRQRQLLLTVDNIEMILVKGSDVPTYVEQGIADVGIVGSDILNGQ-KY 79 
150395194   1 MLRIAIAKGRLMDSLINYLDVIEYTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVEQGMADIGIVGSDILDER-QY 79 
21284327    1 MLRIAIAKGRLMDSLINYLDVIEYTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVEQGMADIGIVGSDILDER-QY 79 
15925669    1 MLRIAIAKGRLMDSLINYLDVIEYTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVEQGMADIGIVGSDILDER-QY 79 
49484874    1 MLRIAIAKGRLMDSLINYLDAIEFTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVEQGIADIGIVGSDILDER-HY 79 
82752257    1 MLRIAIAKGRLMDSLINYLDAIEFTTLSETLKNRERQLLLSVDNIECILVKGSDVPIYVEQGIADIGIVGSDILDER-HY 79 
224476127  81 NINNYIDLPFGECHFSVAAKPNVTNIQRVATTYVKTTRDYFNQKGTDISIIQLSGSVELAAVVDMVDAIVDIVQTGTTLK 160
87162093   80 NVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYFKSKGIDVELIKLNGSVELAGVVDMVDGIVDIVQTGTTLK 159
27467189   80 NINKLLDLPFGKCHFALAAKPETSCYKKVATSYVHTATQFFNKEGMDVEVIHLNGSVELSCVVDMVDAIVDIVQTGSTLT 159
161510886  80 NVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYFKSKGIDVELIKLNGSVELAGVVDMVDGIVDIVQTGTTLK 159
57865757   80 NINKLLDLPFGKCHFALAAKPETSRYKKVATSYVHTATQFFNKEGMDVEVIHLNGSVELSCVVDMVDAIVDIVQTGSTLT 159
150395194  80 NVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYFKSKGIDVELIKLNGSVELACVVDMVDGIVDIVQTGTTLK 159
21284327   80 NVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYFKSKGIDVELIKLNGSVELACVVDMVDGIVDIVQTGTTLK 159
15925669   80 NVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYFKSKGIDVELIKLNGSVELACVVDMVDGIVDIVQTGTTLK 159
49484874   80 NVNNLLNMPFGACHFAVAAKPETTNYRKIATSYVHTAETYFKSKGIDVELIKLNGSVELACVVDMVDGIVDIVQTGTTLK 159
82752257   80 NVNNLLDMPFGACHFAVAAKPETTNYRKIATSYVHTAEAYFKSKGIDVELIKLNGSVELACVVDMVDGIVDIVQTGTTLE 159
224476127 161 SNGLEEREQIGEINARLITNKHSFFSKSKAIENFIQQLGVSIHAQ 205
87162093  160 ANGLVEKQHISDINARLITNKAAYFKKSQLIEQFIRSLEVSIANA 204
27467189  160 ANGLVEKKYISEINAKLITNKESYFKQSSEIERLIKQLGVSISYA 204
161510886 160 ANGLVEKQHISDINARLITNKAAYFKKSQLIEQFIRSLEVSIANA 204
57865757  160 ANGLVEKKHISEINAKLITNKESYFKQSSEIERLIKQLGVSINYA 204
150395194 160 ANGLVEKQHISDINARLITNKAAYFKKSQLIEQFIRSLEVSIANA 204
21284327  160 ANGLVEKQHISDINARLITNKAAYFKKSQLIEQFIRSLEVSIANA 204
15925669  160 ANGLVEKQHISDINARLITNKAAYFKKSQLIEQFIRSLEVSIANA 204
49484874  160 ANGLVEKQHISDINARLITNKAAYFKKSQLIEQFIRSLEVSIANA 204
82752257  160 ANGLVEKQHISDINARLITNKAAYFKKSQLIEQFIRSLEVSIANA 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap