Conserved Protein Domain Family
PRK13486

?
PRK13486: PRK13486 
TonB-dependent receptor
Statistics
?
PSSM-Id: 139606
View PSSM: PRK13486
Aligned: 18 rows
Threshold Bit Score: 1372.41
Threshold Setting Gi: 157145392
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15830614    1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80 
73853323    1 MRITILASVVIPCLGFSASCMA-AEDVMIVSASGYEKKLTNAAASVSVINQEELQSSQYHDLAEALRSVEGVDVESGTGK 79 
26249445    1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80 
170684240   1 MRVTTLASVAIPCLGFSVSSMA-AEDVMVVTASGYEKKLTSAAASVSVISQEDLRSSQYHDLGEALRSVEGVDVESGTGK 79 
218691207   1 MRITTLASVIIPCLGFSASSMAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSRQYHDLAEALRSVEGVDVESGTGK 80 
218697870   1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80 
218706513   1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80 
254792370   1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80 
260867353   1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80 
260857104   1 MRITTLASVVIPCLGFSASSIAaAEDVMIVSASGYEKKLTNAAASVSVISQEELQSSQYHDLAEALRSVEGVDVESGTGK 80 
15830614   81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
73853323   80 TGGLEVSIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITKKN 159
26249445   81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
170684240  80 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGYAAMNTGFMPPLAAIERIEIIRGPMSTLYGSDAMGGVVNIITKKN 159
218691207  81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
218697870  81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
218706513  81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
254792370  81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
260867353  81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
260857104  81 TGGLEISIRGMPASYTLILIDGVRQGGSSDVTPNGFSAMNTGFMPPLAAIERIEVIRGPMSTLYGSDAMGGVVNIITRKN 160
15830614  161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
73853323  160 ADKWHSSINAGLNQQESNKWGNSSQFNFWSSGPLVDDSVSLQIRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 239
26249445  161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
170684240 160 ADKWRSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSLSLQVRGSTQQRQGSSVTSLSDTSATRIPYPTESQNYNAGGR 239
218691207 161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWTSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNIGAR 240
218697870 161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
218706513 161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
254792370 161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
260867353 161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
260857104 161 ADKWLSSVNAGLNLQESNKWGNSSQFNFWSSGPLVDDSVSLQVRGSTQQRQGSSVTSLSDTAATRIPYPTESQNYNLGAR 240
15830614  241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRSV 320
73853323  240 IDWKTTEQDMLWFDMDTTRQRYDNRDGQLGSLTGGYDHTLRYERNKISAGYDHAFTFGTWKSYLNWNETENKGRELVRSV 319
26249445  241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRSV 320
170684240 240 LDWKATDKDVLWIDMDIARQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGAWKSSLNWNETENKGRQLVRSV 319
218691207 241 LDWKATEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHSFTFGTWKSYLNWNETENKGRELVQSV 320
218697870 241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRSV 320
218706513 241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRSV 320
254792370 241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRSV 320
260867353 241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRSV 320
260857104 241 LDWKASEQDVLWFDMDTTRQRYDNRDGQLGSLTGGYDRTLRYERNKISAGYDHTFTFGTWKSYLNWNETENKGRELVRNV 320
15830614  321 LKRDKWGLAGQPRELKESNLILNSLLLTPLGESHLVTVGGEFQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
73853323  320 LKSDKWGLAGKPRELKESNLILNSLLLTPLGESHLVTVGGEYQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 399
26249445  321 LKRDKWGLAGQPRELKESNLILNSLLLTPLGESHLVTVGGEFQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
170684240 320 LQRDKWGLAGQPRELKESNLILSSLLFAPLGESHKVTVGGEYQNSSMKDGVVLASTGETFRQKSWSAFVEDEWYITDAFA 399
218691207 321 LKRDKWELAGQPRELKESNFILNSLLLTPLGESHLVTVGGEYQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
218697870 321 LKRDKWGLAGQPRELKESNLILNSLLLTPLGESHLVTVGGEFQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
218706513 321 LKRDKWGLAGQPRELKESNLILNSLLLTPLGESHLVTVGGEFQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
254792370 321 LKRDKWGLAGQPRELKESNLILNSLLLTPLGESHLVTVGGEFQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
260867353 321 LKRDKWGLAGQPRELKESNLILNSLLLTPLGESHLVTVGGEFQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
260857104 321 LKRDKWGLAGQLRELKESNLILNSLLLTPLGESHLVTVGGEYQSSSMKDGVVLASTGETFRQKSWSVFAEDEWHLTDALA 400
15830614  401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPDLKPEESVSYEA 480
73853323  400 LTAGSRYEHHEQFGGHLSPRAYLVWDVTDAWTLKGGVTTGYKAPSMGQLHKGISGVSGQGRTNLLGNPELKPEESVSYEA 479
26249445  401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPNLKPEESVSYEA 480
170684240 400 LTAGSRYERYEVFGGHFSPRAYMVWDVTDAWTLKGGVTTGYKAPSMGQLHKGISGVSGQGRTNLLGNPDLKPEESVSYEA 479
218691207 401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPTMGQLHKGISGVSGQGRTNLLGNPELKPEESVSYEA 480
218697870 401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPDLKPEESVSYEA 480
218706513 401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPNLKPEESVSYEA 480
254792370 401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPDLKPEESVSYEA 480
260867353 401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPDLKPEESVSYEA 480
260857104 401 LTAGSRYEHHEQFGGHFSPRAYLVWDVADAWTLKGGVTTGYKAPRMGQLHKGISGVSGQGKTNLLGNPDLKPEESVSYEA 480
15830614  481 GVYYDNPAGLNANVTGFMTDFSNKIVSYSINDNTNSYVNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
73853323  480 GVYYDNLAGLNANITGFITDFSNKIVSYSIDDNTNSYTNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTQSEQRDGDNK 559
26249445  481 GVYYDNPAGLNANVTGFMTDFSNKIVSYSINDNTNSYVNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
170684240 480 GVYYDNHAGLNANITGFMTEFSNKIVSYSIDDNTRSYTNSGKARTQGVEFAGTLPLLSEDVTLSLNYTWTQSEQRDGDNK 559
218691207 481 GVYYDNLSGLNANITGFITDFSNKIVSYSIDDNTNSYTNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
218697870 481 GVYYDNPAGLNANVTGFMTDFSNKIVSYSINDNTNSYVNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
218706513 481 GVYYDNPAGLNANVTGFMTDFSNKIVSYSINDNTNSYVNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
254792370 481 GVYYDNPAGLNANVTGFMTDFSNKIVSYSINDNTNSYVNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
260867353 481 GVYYDNPAGLNANVTGFMTDFSNKIVSYSINDNTNSYVNSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
260857104 481 GVYYDNPAGLNANITGFMTDFSNKIVSYSINDNTNSYINSGKARLHGVEFAGTLPLWSEDVTLSLNYTWTRSEQRDGDNK 560
15830614  561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKMTDALT 640
73853323  560 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRDKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGMSWKVTDTLA 639
26249445  561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKMTDALT 640
170684240 560 GAPLSYTPEHMVNAKLNWQITEEVTSWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVLDAGMSWKVTDALM 639
218691207 561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRDKTPRFTRNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKVTDALT 640
218697870 561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKMTDALT 640
218706513 561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKMTDALT 640
254792370 561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKMTDALT 640
260867353 561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKMTDALT 640
260857104 561 GAPLSYTPEHMVNAKLNWQITEEVASWLGARYRGKTPRFTQNYSSLSAVQKKVYDEKGEYLKAWTVVDAGLSWKVTDALT 640
15830614  641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
73853323  640 LNAAVNNVLNKDYSDVSLYRAGSSTLYAGDYFQTGASTTGYVIPERNYWMSLNYQF 695
26249445  641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
170684240 640 LNAAVNNVLNKDYSDVSLYRAGSGTLYAGDYFQTGASTTGYVIPERNYWMSLNYQF 695
218691207 641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
218697870 641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
218706513 641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
254792370 641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
260867353 641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
260857104 641 LNAAVNNLLNKDYSDVSLYSAGKSTLYAGDYFQTGSSTTGYVIPERNYWMSLNYQF 696
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap