Conserved Protein Domain Family
PRK13484

?
PRK13484: PRK13484 
IreA family TonB-dependent siderophore receptor
Statistics
?
PSSM-Id: 139605
View PSSM: PRK13484
Aligned: 5 rows
Threshold Bit Score: 1365.08
Threshold Setting Gi: 197285796
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
117625231   1 MKNKYIIAPGIAVMCSAVISSGYA--SSDKKEDTLVVTASGFTQQLRNAPASVSVITSEQLQKKPVSDLVDAVKDVEGIS 78 
26250982    1 MKNKYIIAPGIAVMCSAVISSGYA--SSDKKEDTLVVTASGFTQQLRNAPASVSVITSEQLQKKPVSDLVDAVKDVEGIS 78 
197285796   1 MKFK------ISALTACILMTSYSlhAQEDKVERLVVSASGFAQQQTDAPASITVINKEQLEKKPIHDLADAVKGVEGVS 74 
218691198   1 MKTKSIIAPGIAVICSTVISSGYA--SSDKKEDTLVVTASGFTQQLRNAPASVSVITSEQLQKKPVSDLVDAVKDVEGIS 78 
218559993   1 MKNKYIIAPGIAVMCSAVISSGYA--SSDKKEDTLVVTASGFTQQLRNAPASVSVITSEQLQKKPVSDLVDAVKDVEGIS 78 
117625231  79 ITGGNEKPDISIRGLSGDYTLILVDGRRQSGRESRPNGSGGFEAGFIPPVEAIERIEVIRGPMSSLYGSDAIGGVINIIT 158
26250982   79 ITGGNEKPDISIRGLSGDYTLILVDGRRQSGRESRPNGSGGFEAGFIPPVEAIERIEVIRGPMSSLYGSDAIGGVINIIT 158
197285796  75 VNGNANKQEITIRGLPGEYTLILVDGRRQNSRESRPNGSGGYEGGFIPPADAIERIEVIRGPMSSLYGSDAMGGVINIIT 154
218691198  79 ITGGNEKPDISIRGLSGDYTLILVDGRRQSGRESRPNGSGGFEAGFIPPVEAIERIEVIRGPMSSLYGSDAIGGVINIIT 158
218559993  79 ITGGNEKPDISIRGLSGDYTLILVDGRRQSGRESRPNGSGGFEAGFIPPVEAIERIEVIRGPMSSLYGSDAIGGVINIIT 158
117625231 159 KPVNNQTWDGVLGLGGIIQEHGKFGNSTTNDFYLSGPLIKDKLGLQLYGGMNYRKEDSISQGTPAKDNKNITATLQFTPT 238
26250982  159 KPVNNQTWDGVLGLGGIIQEHGKFGNSTTNDFYLSGPLIKDKLGLQLYGGMNYRKEDSISQGTPAKDNKNITATLQFTPT 238
197285796 155 KPVTKE-WHGAVSMGGTLQHNRDAGDSINGDFYLSGPLIEDKLGLQLYGSSYLRAEDKITYGQGRNDNKNITAKLAFTPT 233
218691198 159 KPVNNQTWDGVLGLGGIIQEHGKFGNSTTNDFYLSGPLVKDKLGLQLYGGMNYRKEDSISQGTPAKNNKNITATLQFTPT 238
218559993 159 KPVNNQTWDGVLGLGGIIQEHGKFGNSTTNDFYLSGPLIKDKLGLQLYGGMNYRKEDSISQGTPAKDNKNITATLQFTPT 238
117625231 239 ESQKFVFEYGKNNQVHTLTPGESLDAWTMRGNLKQPNSKRETHNSRSHWVAAWNAQGEILHPEIAVYQEKVIREVKSGKK 318
26250982  239 ESQKFVFEYGKNNQVHTLTPGESLDAWTMRGNLKQPNSKRETHNSRSHWVAAWNAQGEILHPEIAVYQEKVIREVKSGKK 318
197285796 234 DNQTILLEAGRNSLQRTTTPGKSMSEFTNRGGRLDKNKMLETNNDRNHWALTYKNQFDILHSELSVYQEQTKRVQKTEGV 313
218691198 239 ESQKFVFEYGKNNQEHTLTPGDSLDAWTMRGNLKQPNSKRETHNSRSHWVAAWNAQGEILHPEIAVYQEKVIREVKSGKK 318
218559993 239 ESQKFVFEYGKNNQVHTLTPGESLDAWTMRGNLKQPNSKRETHNSRSHWVAAWNAQGEILHPEIAVYQEKVIREVKSGKK 318
117625231 319 DKYNHWDLN-YESRKPEITNTIIDAKVTAFLPENVLTIGGQFQHAELRDDSATGKKTTETQSVSIKQKAVFIENEYAATD 397
26250982  319 DKYNHWDLN-YESRKPEITNTIIDAKVTAFLPENVLTIGGQFQHAELRDDSATGKKTTETQSVSIKQKAVFIENEYAATD 397
197285796 314 DKATGNSYKyYEDRRPEITNTVFDAKFTAFLPDNVMTFGGQYQYARLKDESSVGGKEVKQSTITADQKALFLEDEFSVTD 393
218691198 319 DKYNHWDLN-YESRKPEITNTIIDAKVTAFLPENVLTIGGQFQHAELRDDSATGKKTTETQSVSVKQKAVFIENEYAATD 397
218559993 319 DKYNHWDLN-YESRKPEITNTIIDAKVTAFLPENVLTIGGQFQHAELRDDSATGKKTTETQSVSIKQKAVFIENEYAATD 397
117625231 398 SLALTGGLRLDNHEIYGSYWNPRLYAVYNLTDNLTLKGGIAKAFRAPSIREVSPGFGTLTQGGASIMYGNRDLKPETSVT 477
26250982  398 SLALTGGLRLDNHEIYGSYWNPRLYAVYNLTDNLTLKGGIAKAFRAPSIREVSPGFGTLTQGGASIMYGNRDLKPETSVT 477
197285796 394 NLALTGGIRLDDHEYYGKHWNPRAYAVYHLTDEFTIKGGIAKAFKAPSLREISPQYGTSTEKGRAIMYGNRDLKPETSVS 473
218691198 398 SLALTGGLRLDNHEIYGSYWNPRLYAVYNLTDNLTLKGGIAKAFRAPSIREVSPGFGTLTQGGASIMYGNRDLKPETSVT 477
218559993 398 SLALTGGLRLDNHEIYGSYWNPRLYAVYNLTDNLTLKGGIAKAFRAPSIREVSPGFGTLTQGGASIMYGNRDLKPETSVT 477
117625231 478 EEIGIIYSNDSGFSASATLFNTDFKNKLTSYDIGTKDPVTGLNTFIYDNVGEANIRGVELATQIPVYDKWHVSANYTFTD 557
26250982  478 EEIGIIYSNDSGFSASATLFNTDFKNKLTSYDIGTKDPVTGLNTFIYDNVGEANIRGVELATQIPVYDKWHVSANYTFTD 557
197285796 474 QEIGVGYDNGDGFTANVTFFNTEFKDKLTNYDTGEIDPITGLKLYQYDNVGKANIKGIETAVAFPVADNWRVSANYTYIN 553
218691198 478 EEIGIIYNNDSGFSASATLFNTDFKNKLTSYDIGTKDPVTGLNTFIYDNVGEANIRGVELATQIPVYDKWRVSANYTFTD 557
218559993 478 EEIGIIYSNDSGFSASATLFNTDFKNKLTSYDIGTKDPVTGLNTFIYDNVGEANIRGVELATQIPVYDKWHVSANYTFTD 557
117625231 558 SRRKSDDESL-NGKSLKGEPLERTPRHAANAKLEWDYTQDITFYSSLNYTGKQIWAAQRNGAKVPRVRNGFTSMDIGLNY 636
26250982  558 SRRKSDDESL-NGKSLKGEPLERTPRHAANAKLEWDYTQDITFYSSLNYTGKQIWAAQRNGAKVPRVRNGFTSMDIGLNY 636
197285796 554 SKRKSDDEKLgSGESLKGYPLDMTPKHSANARVDWQYDEATSFYANTAYTGKQIWAAQRNGYTGARYRSGYTTFDLGMTY 633
218691198 558 SRRESDDESL-NGKSLKGEPLERTPRHAANAKLEWDYTQDITFYSSLNYTGKQIWAAQRNGAKVPRVRNGFTSMDIGMNY 636
218559993 558 SRRKSDDESL-NGKSLKGEPLERTPRHAANAKLEWDYTQDITFYSSLNYTGKQIWAAQRNGAKVPRVRNGFTSMDIGLNY 636
117625231 637 LILPDTLINFAVLNVTDRKSEDIDTIDGNWQVDEGRRYWANVRVSF 682
26250982  637 QILPDTLINFAVLNVTDRKSEDIDTIDGNWQVDEGRRYWANVRVSF 682
197285796 634 NFNKNTMLNLAVLNITDETGPAVNDKGGNWVVDEGRRYWANIKYSF 679
218691198 637 QFLPGTLINFAVLNVTDRKSEDIDTIDGNWQVDEGRRYWANVRISF 682
218559993 637 LILPDTLINFAVLNVTDRKSEDIDTIDGNWQVDEGRRYWANVRVSF 682
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap