Conserved Protein Domain Family
PRK13466

?
PRK13466: PRK13466 
F0F1 ATP synthase subunit C; Provisional
Statistics
?
PSSM-Id: 172066
View PSSM: PRK13466
Aligned: 9 rows
Threshold Bit Score: 57.6525
Threshold Setting Gi: 253753741
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
253753741  1 MSLGALALGLACLGVSIGEGLLVASYLSSTARQPEMQSKLMAGVFLGVAFIEGTFFVTLAMTFVLK 66 
146318832  1 MSLGALALGLACLGVSIGEGLLVASYLSSTARQPEMQSKLMAGVFLGVAFIEGTFFVTLAMTFVLK 66 
146321042  1 MSLGALALGLACLGVSIGEGLLVASYLSSTARQPEMQSKLMAGVFLGVAFIEGTFFVTLAMTFVLK 66 
253751918  1 MSLGALALGLACLGVSIGEGLLVASYLSSTARQPEMQSKLMAGVFLGVAFIEGTFFVTLAMTFVLK 66 
253755381  1 MSLGALALGLACLGVSIGEGLLVASYLSSTARQPEMQSKLMAGVFLGVAFIEGTFFVTLAMTFVLK 66 
116512629  6 AALGAIAIGLAALGAAIGDGLIVSNFLQAVARQPELEGKLRGSMFMGIAFVEGTFFIALAMAFLFR 71 
125624731  6 AALGAIAIGLAALGAAIGDGLIVSNFLQAVARQPELEGKLRGSMFMGIAFVEGTFFIALAMAFLFR 71 
15674249   6 AALGAIAIGLAALGAAIGDGLIVSNFLQAVARQPELEGKLRGSMFMGIAFVEGTFFIALAMAFLFR 71 
281492362  6 AALGAIAIGLAALGAAIGDGLIVSNFLQAVARQPELEGKLRGSMFMGIAFVEGTFFIALAMAFLFR 71 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap