Conserved Protein Domain Family
PRK13463

?
PRK13463: PRK13463 
phosphoserine phosphatase 1
Statistics
?
PSSM-Id: 172065
View PSSM: PRK13463
Aligned: 19 rows
Threshold Bit Score: 339.332
Threshold Setting Gi: 222095689
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
218903192   1 MKTTVYVTRHGETEWNVAKRMQGRKNSTLTENGILQAKQLGERMKDLSIHAIYSSPSERTLHTAELIKGERDIPIIADEH 80 
42781179    1 MKTTVYVTRHGETEWNVAKRMQGRKNSALTENGILQAKQLGERMKDLSIHAIYSSPSERTLHTAELIKGERDIPIIADEH 80 
30020166    1 MKTTIYVTRHGETEWNVAKRMQGRKNSALTENGIVQAKQLGNRMKDLPIHAIYSSPSERTLHTAELIKGERDIPIIADEH 80 
52143385    1 MKTTVYVTRHGETEWNVAKRMQGRKNSALTENGILQAKQLGERMKDLSIHAIYSSPSERTLHTAELIKGERDIPIIADAH 80 
222095689   1 -------------------------------------------MKDLSIHAIYSSPSERTLHTAELIKGERDIPIIADEH 37 
218897035   1 MKTTIYVTRHGETEWNVVKRMQGRKNSALTENGIVQAKQLGNRMKDLPIHAIYSSPSERTLHTAELIKGERDIPIIADEH 80 
218235331   1 MKTTIYVTRHGETEWNVAKRMQGRKNSALTENGIVQAKQLGNRMKDLPIHAIYSSPSERTLHTAELIKGERDIPIIADEH 80 
217959546   1 MKTTVYVTRHGETEWNVAKRMQGRKNSALTENGILQAKQLGERMKDLSIHAIYSSPSERTLHTAELIKGERDIPIIADEH 80 
301053586   1 MKTTVYVTRHGETEWNVAKRMQGRKNSTLTENGILQAKQLGERMKDLSIHAIYSSPSERTLHTAELIKGERDIPIIADEH 80 
296502648   1 MKTTIYITRHGETEWNVAKRMQGRKNSALTENGIVQAKQLGNRMKDLPIHAIYSSPSERTLHTAELIKGERDIPIIADEH 80 
218903192  81 FYEINMGIWEGQTIDDIERQYPDDIQLFWNEPHLFQSTSGENFEAVHKRVIEGIQLLLEKHKGESILIVSHAAAAKLLVG 160
42781179   81 FYEISMGIWEGQTIDDIERQYPDDIQLFWYEPHLFQSTSGENFEAVHKRVIEGMQILLEKHKGESILIVSHAAAAKLLVG 160
30020166   81 FYEINMGIWEGQTIADIEKQFPEEVHLFWNEPHLFQSTSGENFEAVYERVIEGMQLLLEKHKGQNILIVSHAAAAKLLVG 160
52143385   81 FYEISMGIWEGQTIDDIERQYPNDIQLFWYEPHLFQSTSGENFEAVHKRVIEGMQILLEKHKGESILIVSHAAAAKLLVG 160
222095689  38 FYEISMGIWEGQTIDDIERQYPDDIQLFWYEPHLFQSTSGENFEAVHKRVIEGMQLLLEKHKGESILIVTHAAAAKLLVG 117
218897035  81 FYEINMGIWEGQTIADIEKQFPEEVHLFWNEPHLFQSTSGENFEAVYERVIEGMQLLLEKHKGQSILIVSHAAAAKLLVG 160
218235331  81 FYEINMGIWEGQTIADIEKQFPEEVHLFWNEPHLFQSTSGENFEAVYERVIEGMQLLLEKHKGQNILIVSHAAAAKLLVG 160
217959546  81 FYEISMGIWEGQTIDDIERQYPDDIQLFWYEPHLFQSTSGENFEAVHKRVIEGMQLLLEKHKGESILIVSHAAAAKLLVG 160
301053586  81 FYEINMGIWEGQTIDDIERQYPDDIQLFWNEPHLFQSTSGENFEAVHKRVIEGMQLLLEKHKGESILIVSHAAAAKLLVG 160
296502648  81 FYEINMGIWEGQTIADIEKQFPEEVHLFWNEPHLFQSTSGENFEAVYERVIEGMQLLLEKHKGQNILIVSHAAAAKLLVG 160
218903192 161 HFAGIEIENVWGDPFMHSASLSIIEFEDgeGEGEVKQFADISHFQ 205
42781179  161 HFAGIEIENVWDDPFMHSASLSIIEFEE--DKGEVKQFADISHFQ 203
30020166  161 HFAGIEIENVWDDPFMHSASLSIIEFEE--GIGKVKQFADISHFQ 203
52143385  161 HFAGIEIENVWDDPFMHSASLSIIEFEE--DKGEVKQFADISHFQ 203
222095689 118 HFAGIEIENVWNDPFMHSASLSIIEFED--GKGEVKQFADISHFQ 160
218897035 161 HFAGIEIENVWDDPFMHSASLSIIEFEE--GIGKVKQFADISHFQ 203
218235331 161 HFAGIEIENVWDDPFMHSASLSIIEFEE--GIGKVKQFADISHFQ 203
217959546 161 HFAGIEIENVWNDPFMHSASLSIIEFED--GKGEVKQFADISHFQ 203
301053586 161 HFAGIEIENVWDDPFMHSASLSIIEFED--GKGEVKQFADISHFQ 203
296502648 161 HFAGIEIENVWDDPFMHSASLSIIEFEE--GIGKVKQFADISHFQ 203
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap