Conserved Protein Domain Family
PRK13462

?
PRK13462: PRK13462 
acid phosphatase; Provisional
Statistics
?
PSSM-Id: 139587
View PSSM: PRK13462
Aligned: 20 rows
Threshold Bit Score: 366.464
Threshold Setting Gi: 169630615
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108798359   1 MGLTDHRLLLIRHGETEWSRSGRHTSRTDLGLTETGRDQATQTAAALDRLTLDNPLVISSPRLRALDTAKLAGLAVDEVS 80 
126434024   1 MGLTDHRLLLIRHGETEWSRSGRHTSRTDLGLTETGRDQATQTAAALDRLTLDNPLVISSPRLRALDTAKLAGLAVDEVS 80 
119867456   1 MGLTDHRLLLIRHGETEWSRSGRHTSRTDLGLTETGRDQATQTAAALDRLTLDNPLVISSPRLRALDTAKLAGLAVDEVS 80 
118466548   1 MGLHNHRLVLLRHGETEWSKTGRHTGRTEVELTEAGRTQAERAGRALSELKLVEPLVISSPRQRSLATAELAGLNVDEVS 80 
41409413   24 MGLHNHRLVLLRHGETEWSKTGRHTGRTEVELTEAGRTQAERAGRALSELKLVEPLVISSPRQRSLATAELAGLNVDEVS 103
118469838   1 MSVQQHRLLLLRHGETEWSASGRHTGRTDLDLTEAGREQAKLAAEPLAELQLRDPLVFSSPRRRALVTAELAGLTVAEEL 80 
183981366  13 MGVHNHRLLLLRHGDTEWSKSGKHTGRTDIELTETGRAQAELAGRALNELELDNPLVISSPRKRTLATAELAGLTVDTVA 92 
145225257  25 VGLLQHRLILLRHGETEWSKSGKHTSSTELELTEHGRAQARAAADTLKQMELDDPYVVSSPRVRATTTADLAGLTVDEVS 104
118618018  26 MGVHNHRLLLLRHGDTEWSKSGKHTGRTDIELTETGRAQAELAGRALNELELDNPLVISSPRKRTLATAELAGLTVDTVS 105
224991593   1 MGVRNHRLLLLRHGETAWSTLGRHTGGTEVELTDTGRTQAELAGQLLGELELDDPIVICSPRRRTLDTAKLAGLTVNEVT 80 
108798359  81 DLLVEWDYGDYEGRTTAEIRESDPEWLVWTHGCPGGESVEAVSERADRAVEVALGHLESRDVIFVGHGHFSRAVITRWAE 160
126434024  81 DLLVEWDYGDYEGRTTAEIRESDPEWLVWTHGCPGGESVEAVNERADRAVEVALGHLESRDVIFVGHGHFSRAVITRWAE 160
119867456  81 DLLVEWDYGDYEGRTTAEIRESDPEWLVWTHGCPGGESVEAVSERADRAVEVALGHLESRDVIFVGHGHFSRAVITRWAE 160
118466548  81 EQLAEWDYGSYEGLTTEQIRQSVPDWLVWTHGCPGGESVAQVSGRADAAVTAALRQMESRDVVFVSHGHFCRAVMTRWVE 160
41409413  104 EQLAEWDYGSYEGLTTEQIRQSVPDWLVWTHGCPGGESVAQVSGRADAAVTAALRQMESRDVVFVSHGHFCRAVMTRWVE 183
118469838  81 PLLAEWDYGNYEGLTTAQIRETEPDWLVWKHGCPGGESVEEVGERADRAVALALEYLEDRDVVFVGHGHFSRAVLARWVE 160
183981366  93 ELVAEWDYGSYEGLTTPQIREFEPNWLVWTHGCPGGESVQQVTERADRAIALALEHMTSRDVVFASHSHFSRSVITRWVE 172
145225257 105 PLVSEWDYGDYEGTTTADIRKAVPNWLVWTHGCPGGETSAQVCARADQAIDVALGHMESRDVVFVGHGHFSRAVITRWIE 184
118618018 106 ELVAEWDYGSYEGLITPQIREFEPNWLVWTHGCPGGESVQQVTERADRAIALALEHMTSRDVVFASHSHFSRSVTTRWVE 185
224991593  81 GLLAEWDYGSYEGLTTPQIRESEPDWLVWTHGCPAGESVAQVNDRADSAVALALEHMSSRDVLFVSHGHFSRAVITRWVQ 160
108798359 161 LPLTDGIRFAMVAASIAVCGWEHGVRQISALALTGYPHPCLPT 203
126434024 161 LPLADGIRFAMVAASIAVCGWEHGVRQISALALTGYPHPCLPT 203
119867456 161 LPLTDGIRFAMVAASIAVCGWEHGVRQISALALTGYPHPCLPT 203
118466548 161 LPLAEGSRFAMITASIAVCGFEHGVRQLRALGLT--------- 194
41409413  184 LPLAEGSRFAMITASIAVCGFEHGVRQLRALGLT--------- 217
118469838 161 LPVTHGIRISMVPASIGVCGFEHGVRQISALGLTGHPNPCLPQ 203
183981366 173 LALVEGSRFYMPTASIAICGFEHGVRQLSALGLKGFSDS---- 211
145225257 185 QPVYEGIRFAMPAASIAVCGFEHGVRQLSALAQTGLPNPAVST 227
118618018 186 LALVEGSRFYMPTASIAICGFEHGVRQLSALGLKGFSDS---- 224
224991593 161 LPLAEGSRFAMPTASIGICGFEHGVRQLAVLGLTGHPQPIAAG 203
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap