Conserved Protein Domain Family
PRK13460

?
PRK13460: PRK13460 
F0F1 ATP synthase subunit B; Provisional
Statistics
?
PSSM-Id: 139585
View PSSM: PRK13460
Aligned: 6 rows
Threshold Bit Score: 230.297
Threshold Setting Gi: 45657122
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45657122    1 MVLLAAKGLSLLDVNPGLVVWTLVTFLVVVLVLKKFAWDVILKALDERAETVQNDIKKASELRLEAEALLKDYEARLNSA 80 
24215481    1 MVLLAAKGLSLLDVNPGLVVWTLVTFLVVVLVLKKFAWDVILKALDERAETVQNDIKKASELRLEAEALLKDYEARLNSA 80 
189910329   1 MVLLAASGFNLLKVNPGLVIWTLVTFSVVVFVLKKFAWDKILHALEERASGIQGDINKAESLRVEAEKSLKEYKDQLFKA 80 
183220211   1 MVLLAASGFNLLKVNPGLVIWTLVTFSVVVFVLKKFAWDKILHALEERASGIQGDINKAESLRVEAEKSLKEYKDQLFKA 80 
116328617   1 MILLAAKGLSLLDVNPGLVVWTLITFLVVVLVLKKFAWDVILKALDERAQAVQNDIEKASELRLEAEALLKDYEARLNSA 80 
116331346   1 MILLAAKGLSLLDVNPGLVVWTLITFLVVVLVLKKFAWDVILKALDERAQAVQNDIEKASELRLEAEALLKDYEARLNSA 80 
45657122   81 KDEANAIVAEAKSDALKLKNKLLEETNGEVKAQKDQAVKEIELAKAKALGQLQAQIVEMTITVAAKVLEKQLKSEDYKAF 160
24215481   81 KDEANAIVAEAKSDALKLKNKLLEETNGEVKAQKDQAVKEIELAKAKALGQLQAQIVEMTITVAAKVLEKQLKSEDYKAF 160
189910329  81 TEEAHRIVDEAKKDAVALRTKLTEEAHNEVKGIKDSAVREIELAKGRALSEIQNQIVEMSVLIASEILEKQLKKEDYASF 160
183220211  81 TEEAHRIVDEAKKDAVALRTKLTEEAHNEVKGIKDSAVREIELAKGRALSEIQNQIVEMSVLIASEILEKQLKKEDYASF 160
116328617  81 KDEANAIVAEARSDALKLKNKLLEETNQEVKAQKDQAVKEIELAKGKALEQLQTQFVEMTITIAGKVLEKQLKAEDYKAF 160
116331346  81 KDEANAIVAEARSDALKLKNKLLEETNQEVKAQKDQAVKEIELAKGKALEQLQTQFVEMTITIAGKVLEKQLKAEDYKAF 160
45657122  161 IETELDKLGKLSA 173
24215481  161 IETELDKLGKLSA 173
189910329 161 VEKEIAKLDKLKI 173
183220211 161 VEKEIAKLDKLKI 173
116328617 161 IETELNKLGKLSA 173
116331346 161 IETELNKLGKLSA 173
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap