Conserved Protein Domain Family
atpC

?
PRK13452: atpC 
F0F1 ATP synthase subunit epsilon; Provisional
Statistics
?
PSSM-Id: 106409
View PSSM: PRK13452
Aligned: 9 rows
Threshold Bit Score: 235.025
Threshold Setting Gi: 167627187
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118498207   1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIM 80 
167627187   1 MTKKYLKVDVVSPLGSVFKGEADIVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDEHTDVLYVSGGIVEVTPTRVTIM 80 
56707244    1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIM 80 
110669714   1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIM 80 
134301279   1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIM 80 
89257057    1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIVYGHTELLSTLPAGVVNVRKGQHTDVLYVSGGIVEVTPTRVTIM 80 
115315413   1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIVYGHTELLSTLPAGVVNVRKGQHTDVLYVSGGIVEVTPTRVTIM 80 
156503267   1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIVYGHTELLSTLPAGVVNVRKGQHTDVLYVSGGIVEVTPTRVTIM 80 
187931021   1 MTKKYLKVDVVSPLGSVFKGEADMVSLRGSAGEMGIAYGHTELLSTLPAGVVNVRKDQHTDVLYVSGGIVEVTPTRVTIM 80 
118498207  81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
167627187  81 VDDMERAENLNQAEAEKARARAQEALKNPDASKLDIEAASKRLSEADARLKALNSSKGLYYSKED 145
56707244   81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
110669714  81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
134301279  81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
89257057   81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
115315413  81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
156503267  81 VDDMERAENLNQAEAEKARARAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
187931021  81 VDDMERAENLNQAEAEKARVRAKEVLKNPDASKLDIEAANKRLKEADARLKALNSSNGLYYSKDD 145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap