Conserved Protein Domain Family
atpC

?
PRK13451: atpC 
F0F1 ATP synthase subunit epsilon; Provisional
Statistics
?
PSSM-Id: 172059
View PSSM: PRK13451
Aligned: 8 rows
Threshold Bit Score: 134.53
Threshold Setting Gi: 217076684
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
154249021   1 MKIKIVTPYKIMEFSNAKILVFKTVEGEMGVLDKRAPLIAKLAVTDVRIKTEDGEEKYRVVDGFIHCDGnSNVTILTEEV 80 
170289061   1 MKVKIVTPYGIVYDRESDFISFRTVEGSMGILPRRAPIVTQLSVCDVKIKSGDDEYHLKVAGGFLLCDG-KDVIIITEEA 79 
15644357    1 MKVKIVTPYGIVYDRESDFISFRTVEGSMGILPRRAPIVTQLSVCDVKIKSGDDEYHLKVAGGFLLCDG-KDVIIITEEA 79 
222099823   1 MKVKIVTPYGTVFDRESDFVSFRTVEGAMGILPRRAPIITQLSVCDVKIKSGEEEFRLKVAGGFLVCDG-KEVTIITEEA 79 
148270312   1 MKVKIVTPYGIVYDRESDFISFRTVEGSMGILPRRAPIVTQLSVCDVKIKSGDDEYHLKVAGGFLLCDG-KDVIIITEEA 79 
281412619   1 MKVKIVTPYGIVYDRESDFISFRTVEGSMGILPRRAPIVTQLSVCDVKIKSGDDEYHLKVAGGFLLCDG-KDVIIITEEA 79 
150020192  14 LRLKIFYPNGLFLDEEVDIVTVRTVEGEMGILKNRAPIIAKLRVDKIIVKKFDKKFEYIIDDGFLHCDG-ENVIILTEDV 92 
217076684   1 MKLKIYSPNGLMFEKDVTVVTVRTVEGEMGLLERRAPIIAKLRVDKVVAKDNTQTYEYVIDDGFLHCDG-ENVIIVTEDI 79 
154249021  81 GKPEEFDPHKYLGDGISSGKAD 102
170289061  80 GREEDISPDRFMEARERVERVR 101
15644357   80 GREEDISPDRFMEARERVERVR 101
222099823  80 GREEDISPDRFMEARERVERVR 101
148270312  80 GREEDISPDRFMEARERVERVR 101
281412619  80 GREEDISPDRFMEARERVERVR 101
150020192  93 --KNEINPHEYLGG-------- 104
217076684  80 --KKEIDPHKYLGG-------- 91 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap