Conserved Protein Domain Family
atpC

?
PRK13448: atpC 
F0F1 ATP synthase subunit epsilon; Provisional
Statistics
?
PSSM-Id: 139579
View PSSM: PRK13448
Aligned: 13 rows
Threshold Bit Score: 215.793
Threshold Setting Gi: 92116486
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
92116486    1 MTRFQVSLVSPESLLFSGQVDQVDLPGIEGDLGVLAGHAPIVVMLRPGIVTTVAGDIRDRFVILGGLAEFSQGELTILAD 80 
146337565   1 MATFHFDLVSPEKIAFSGEVDQVDVPGQEGDFGVLAGHAPFVATLRPGILTVTTGGTQQKIIVLGGLAEISEKGLTILAD 80 
148252016   1 MATFHFDLVSPEKIAFSGEVDQVDVPGQEGDFGVLAGHAPFVATLRPGILTVTAGGTQQKIIVLGGLAEISEKGLTILAD 80 
27375550    1 MATFHFDLVSPEKLAFSGEVDQVDIPGVEGDFGVLAGHAPVVAAIRPGILTVTTAGRHEKIIVLGGLAEVSEKGLTVLAD 80 
92116149    1 MATFHFDLVSPEKLTFSGDVDQVDVPGVEGDFGVLAGHAPVVAAIRPGILTITTGGTPQKIIVLGGLAEVSEKGLTVLAD 80 
75674632    1 MATFHFDLVSPEKLAFSGEVDQVDIPGVEGDFGVLAGHAPVVAAIRPGMLTVTAGGTQQKIIVLGGLAEVSEKGLTVLAD 80 
39933252    1 MSTFHFDLVSPEMVAFSGDVDQVDIPGAEGDFGVLAGHAPVVAVIRPGILTVTAGANKQKIVVLGGIAEVSDKGLTVLAD 80 
115522307   1 MATFHFDLVSPEKLAFSGEVDQVDVPGIEGDFGVLANHAPVVAVIRPGILTVITGGNQQKIVVLGGIAEVSEKGLTVLAD 80 
90421697    1 MATFQFDLVSPEKLAFSGQVDQVDIPGVEGDFGVLAGHAPVVAVIRPGLLTITAGGNQQKIVVLGGLAEVSDKGLTVLAD 80 
91975040   17 MATFHFDLVSPEQVAFSGEVDQVDIPGAEGDFGVLAGHAPVVAVIRPGILTVTAGGAQQKIVVLGGIAEVSEKGLTVLAD 96 
86747390    5 MATFHFDLVSPEMVAFSGEVDQVDIPGAEGDFGVLAGHAPVVAVIRPGILTVTAGGAQQKIVVLGGIAEVSEKGLTVLAD 84 
192288603   1 MSTFHFDLVSPEMVAFSGDVDQVDIPGAEGDFGVLAGHAPVVAVIRPGILTVTAGANKQKIVVLGGIAEVSDKGLTVLAD 80 
209883748   1 MATFHFDLVSPEKIAFSGEVEQVDVPGVEGDFGVLAGHSPLVASVRPGILTVTIGGKHEKIIVLGGLAEVSEKGLTVLAD 80 
92116486   81 SASSVDGFDLTRLKAQIDEMQESLAKQsVGDELDRAVAKFDHFKAIHTALAPATAF 136
146337565  81 VATSLKELDQTAFATEISGMEAKLNEK-QGDELDRAIERLDHFKTIQQQLNTTALH 135
148252016  81 VATSLKELDQTAFAAEISGMEAKLNEK-QGNELDRAIERLDHFKTIQQQLNTTALH 135
27375550   81 VATSLDELDRAQFAETIAEMEEGLKEH-EGGELDLAIERLDHYKSIQQQLSSTAMH 135
92116149   81 VATSIQELDRAQFADTIASMEAKLAEK-EGSELDKAIERLDHFKSIQSQLNTTALH 135
75674632   81 VATSIEELDRAQFADTIAGMEARLTDK-EGSELDKAIERLDHFKSIQSQLNTTAMH 135
39933252   81 VATPAPDVDLQDFAATIQTMEQQIPGK-VGDELDRAIERLDHFKSIQHELNTTAMH 135
115522307  81 VATSVADLDAAMFAQTVSSMESALAGK-QGSELDRAIERLDHYKNIQHQLTATAMH 135
90421697   81 VATSVAELDTAQFAQTISSMESSLAGK-QGSELDRAIERLDHYKSIQHQLNATAMH 135
91975040   97 VATAVADLDMQDFAATIATMEQQLPGK-VGDVLDRSIERLDHYKSIQHQISTTAMH 151
86747390   85 VATATADVDMQDFAETITTMEQQLPGK-VGDELDRSIERLDHYKSIQHQLSTTAMH 139
192288603  81 VATPAPDVDLQDFAATIQTMEQQIPGK-VGDELDRAIERLDHFKSIQHELNTTAMH 135
209883748  81 TATSLADLDRAAFARQIEEMESNLKNEePGNELDKAIARLDHFKVIQQHITSTGMH 136
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap