Conserved Protein Domain Family
atpC

?
PRK13444: atpC 
F0F1 ATP synthase subunit epsilon; Provisional
Statistics
?
PSSM-Id: 139576
View PSSM: PRK13444
Aligned: 6 rows
Threshold Bit Score: 206.267
Threshold Setting Gi: 189910334
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
45657127    1 MSANKLKVSVISPEKILYKGEVDSLIVPGSEGFFGILPNHAPLVATLGIGILEIRKGEKLKVLSVEGGFVEIKDNSISIL 80 
24215475    1 MSANKLKVSVISPEKILYKGEVDSLIVPGSEGFFGILPNHAPLVATLGIGILEIRKGEKLKVLSVEGGFVEIKDNSISIL 80 
189910334   1 -MSKELTLTVISPDKILYQGKAESVILPGAVGYFGILPGHATLVSQLDFGLIKLHTAGKEFRIAIDGGFCEVKNDQIRVL 79 
183220216   1 -MSKELTLTVISPDKILYQGKAESVILPGAVGYFGILPGHATLVSQLDFGLIKLHTAGKEFRIAIDGGFCEVKNDQIRVL 79 
116328612   1 MFAHKLNVSVISPEKILYKGEVDSLVVPGSEGFFGILPNHAPLVATLGIGVLEIRKGEKLKNISVEGGFIEVKDNTVSIL 80 
116331341   1 MFAHKLNVSVISPEKILYKGEVDSLVVPGSEGFFGILPNHAPLVATLGIGVLEIRKGEKLKNISVEGGFIEVKDNTVSIL 80 
45657127   81 TDHGALKEDIDLEVEKKNLAEAEKLPPSDSKNLFLQKTKTRILVASR 127
24215475   81 TDHGALKEDIDLEVEKKNLAEAEKLPPSDSKNLFLQKTKTRILVASR 127
189910334  80 TEGGDSEDDLSHDHAIELLQEAEALPTSKEKENLLKKAKVRILLHER 126
183220216  80 TEGGDSEDDLSHDHAIELLQEAEALPTSKEKENLLKKAKVRILLHER 126
116328612  81 TDHGALKEDIDIEAEKKALAEVEKLSPSDSKNLLLQKTKTRILVASR 127
116331341  81 TDHGALKEDIDIEAEKKALAEVEKLSPSDSKNLLLQKTKTRILVASR 127
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap