Conserved Protein Domain Family
PRK13434

?
PRK13434: PRK13434 
F0F1 ATP synthase subunit delta; Provisional
Statistics
?
PSSM-Id: 139571
View PSSM: PRK13434
Aligned: 6 rows
Threshold Bit Score: 282.207
Threshold Setting Gi: 189910330
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189910330   1 MSLNQISKVYATALLElaqEANSLESTEEELSSLVGVFFSDDTIRHYFLSPLVDPSEKEQTAAKSVQGKASEIVANFITL 80 
45657123    1 MNDSGVSKTYASALLG---ATNVPEEVEQELGDLAQLLFKDEKVKNFFLSPTVSNEEKEKVLIKNLRGKISDITLNFLGV 77 
24215480    1 MNDSGVSKTYASALLG---ATNVPEEVEQELGDLAQLLFKDEKVKNFFLSPTVSNEEKEKVLIKNLRGKISDITLNFLGV 77 
183220212   1 MSLNQISKVYATALLElaqEANSLESTEEELSSLVGVFFSDDTIRHYFLSPLVDPSEKEQTAAKSVQGKASEIVANFITL 80 
116328616   1 MNDSGVSKIYASALLG---AVNSPEEVEQELGDLVQLLFKEEKIRNFFLSPTVSIEEKENILEKNLRGKILDVTLNFLGV 77 
116331345   1 MNDSGVSKIYASALLG---AVNSPEEVEQELGDLVQLLFKEEKIRNFFLSPTVSIEEKENILEKNLRGKILDVTLNFLGV 77 
189910330  81 VVRKNRFLYLKDILEDYRSGVDRLKNRSSLRIVSKDSLGKEAVDQITKSISSKFGREVRVTEHTDLNLIGGFKIYIDDFL 160
45657123   78 LLNRGRIIHLPEIQKQFTVELDKKKGRVRAQVRSYPSLEPAQAAKLGSILSEKFKSEFILEVSEDKSLLGGFVVQFNDLK 157
24215480   78 LLNRGRIIHLPEIQKQFTVELDKKKGRVRAQVRSYPSLEPAQAAKLGSILSEKFKSEFILEVSEDKSLLGGFVVQFNDLK 157
183220212  81 VVRKNRFLYLKDILEDYRSGVDRLKNRSSLRIVSKDSLGKEAVDQITKSISSKFGREVRVTEHTDLNLIGGFKIYIDDFL 160
116328616  78 LLNKGRFINLPEIQKRFTVELDKKKGRVRAQIKSYPSLEPAQITKLGSILSEKFKSEFILEVSEDKTLLGGFVVQFNDLK 157
116331345  78 LLNKGRFINLPEIQKRFTVELDKKKGRVRAQIKSYPSLEPAQITKLGSILSEKFKSEFILEVSEDKTLLGGFVVQFNDLK 157
189910330 161 IDASIRAKLAGTREALLQKKIPVGAFE 187
45657123  158 IEKSIASQLGEIKKSMLEKKLPVGAIY 184
24215480  158 IEKSIASQLGEIKKSMLEKKLPVGAIY 184
183220212 161 IDASIRAKLAGTREALLQKKIPVGAFE 187
116328616 158 IEKSIASQLGEIKKAMLEKKLPVGAVY 184
116331345 158 IEKSIASQLGEIKKAMLEKKLPVGAVY 184
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap