Conserved Protein Domain Family
PRK13427

?
PRK13427: PRK13427 
F0F1 ATP synthase subunit gamma; Provisional
Statistics
?
PSSM-Id: 172049
View PSSM: PRK13427
Aligned: 7 rows
Threshold Bit Score: 460.177
Threshold Setting Gi: 226226121
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
189910332   1 MATPREIKKRINSVKNTRKITRTMEMVSTAKAKKATNKVNAAKPYADLTRELVSSLSSLASIIHSPYLRKPDKIRKVAIL 80 
45657125    1 MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKELVSSLASLGGVVHSPYLRRPEKIKTVALL 80 
229020021   1 MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKELVSSLASLGGVVHSPYLRRPEKIKTVALL 80 
183220214   1 MATPREIKKRINSVKNTRKITRTMEMVSTAKAKKATNKVNAAKPYADLTRELVSSLSSLASIIHSPYLRKPDKIRKVAIL 80 
116328614   1 MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKELVSSLASLSGVVHSPYLRRPEKIKTVALL 80 
116331343   1 MATPREIKKRINSVKNTRKITRTMEMVSTAKSKKISDRVNASHPFSNKIKELVSSLASLSGVVHSPYLRRPEKIKTVALL 80 
226226121   1 MAKGKELKGRIRSTENTRKITRTMEMVATSKLKRATDRVAAARPYALALGEVLSHVYSPELADRFPLLRRPAAPRTVALV 80 
189910332  81 AIAANRGLCGGFNSNLLRMVKNRIEELKSKGVEVEVHAAGKKAISFFKFAKVELVTSYTNIDDKAGSKEANDLASYFMER 160
45657125   81 IITANRGLCGGYNSNVNRMAKAKIQEWKKSGVNVRLFIVGKKGISFFKFAGEKAEKTYTHLDDKSGYREAEEFANLFLEL 160
229020021  81 IITANRGLCGGYNSNVNRMAKAKIQEWKKSGVNVRLFIVGKKGISFFKFAGEKAEKTYTHLDDKSGYREAEEFANLFLEL 160
183220214  81 AIAANRGLCGGFNSNLLRMVKNRIEELKSKGVEVEVHAAGKKAISFFKFAKVELVTSYTNIDDKAGSKEANDLASYFMER 160
116328614  81 VITANRGLCGGYNSNVNRLAKAKVAEWKKAGVNVRLFIVGKKGISFFKFAGEKAEKTYTHLDDKSGYKEAEEFANLFLEL 160
116331343  81 VITANRGLCGGYNSNVNRLAKAKVAEWKKAGVNVRLFIVGKKGISFFKFAGEKAEKTYTHLDDKSGYKEAEEFANLFLEL 160
226226121  81 ILTANRGLCGAFNANLIKEARSRIAELEAKGLTVELHVVGRKGVGFFRYVNRAIASQRTDITDKPSAADAASLIDGLMQR 160
189910332 161 FANESVDSVEIISTHYYSAANQKPETTTVLPLQMeetGSKGSSGPEVLYEPDPKTILENLLPMVIKTTFVKIILESVASE 240
45657125  161 FAKEEVDVVEIASTVYYSSASQKPEVTRVLPLEP---AGEGSVSDMMVYEPSPEKVLESLLPLVVKTAFLKAILEANCSE 237
229020021 161 FAKEEVDVVEIASTVYYSSASQKPEVTRVLPLEP---AGEGSVSDMMVYEPSPEKVLESLLPLVVKTAFLKAILEANCSE 237
183220214 161 FANESVDSVEIISTHYYSAANQKPETTTVLPLQMeetGSKGSSGPEVLYEPDPKTILENLLPMVIKTTFVKIILESVASE 240
116328614 161 FANEEVDAVEIASTVYYSSASQKPEVTRILPFEP---AKEGNGNDLVVYEPSPERVLESLLPLVVKTAFLKAILEANCSE 237
116331343 161 FANEEVDAVEIASTVYYSSASQKPEVTRILPFEP---AKEGNGNDLVVYEPSPERVLESLLPLVVKTAFLKAILEANCSE 237
226226121 161 FAAGSIDAVYITYAKYLSALSAPPATEQVLPVAPptaKAEGGVQHDFILAPSADAILEALLPLYVRNAVYRALVETEAGF 240
189910332 241 HIARRVAMKAATDAAGEMIKLLTRGYNRVRQAKITQEISEIVGGAEAIS 289
45657125  238 QIARRIAMKSATDAASEMIKLLTRGYNRVRQAKITQEISEIVAGADSLN 286
229020021 238 QIARRIAMKSATDAASEMIKLLTRGYNRVRQAKITQEISEIVAGADSLN 286
183220214 241 HIARRVAMKAATDAAGEMIKLLTRGYNRVRQAKITQEISEIVGGAEAIS 289
116328614 238 QIARRIAMKSATDAASEMIKLLTRGYNRVRQAKITQEISEIVAGADSLN 286
116331343 238 QIARRIAMKSATDAASEMIKLLTRGYNRVRQAKITQEISEIVAGADSLN 286
226226121 241 QSAQRTAMKNATDNATELLQVLKRTYNSARQAQITQEIAEIVGGASALQ 289
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap