Conserved Protein Domain Family
PRK13425

?
PRK13425: PRK13425 
F0F1 ATP synthase subunit gamma; Provisional
Statistics
?
PSSM-Id: 139564
View PSSM: PRK13425
Aligned: 11 rows
Threshold Bit Score: 539.399
Threshold Setting Gi: 193214590
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
193214590   1 MATLREIRTRIKSVKSTQQLTKAMKMVAAAKLRRAQDRALQARPYAAKLKELLDSLSGKVDTTINPLLTPRSEVKNVLVI 80 
189347804   1 MPTLKDIRVRIKGIKSTQQVTKAMKMVAAAKLRRAQERAIMARPYAGKLKEMLGSLSAKVDTSLNPLLSSRQDVKKVLVI 80 
145220430   1 MPTLKDIRVRIKGVTSTQQVTKAMKMVAAAKLRRAQERAVMARPYAAKLSEMLGSLSAKVDTSENPLLSGRSEVRGALVI 80 
119358311   1 MPTLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRRAQERAIMARPYARKLKEMLGSLSDKVDTSLNPLLSNRSEVNKVVVI 80 
189499278   1 MATLKDIRTRIQSIASTQQVTKAMKMVSAAKLRRAQDSAIQARPYAAKLKEMLGSLSTRVDTTLNPLLSDRDEVKNVLVV 80 
78188124    1 MATLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRRAQDRAIMARPYASKLKEMLASLSAKVDTSVNPLFAVRSEVNKVLVI 80 
78187826    1 MPTLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRKAQERAVMARPYAAKLKEMLGSLSGKVDTSASPLLADRADASRVLVV 80 
194337685   1 MPTLKDIRVRIKGVKSTQQVTKAMKMVAAAKLRRAQERAVMARPYAKKLKEMLGSLSAKVDTSRNPMLSGRSEVNKVLVI 80 
194333107   1 MATLKDIRTRIKGVKSTQQVTKAMKMVAAAKLRRAQESAVQARPYAAKLKEMLGSLSTKVDTSLNPMLSARDEVGRVLVV 80 
193213547   1 MPTLKDIRIRLKGIKSTQQVTKAMKMVAAAKLRRAQDRAIQARPYAGKLKEMLASLSTKVDTSLNPLLSPREEVNKVLVV 80 
21674842    1 MPTLKDIRIRLKGVKSTQQVTKAMKMVAAAKLRRAQDRAIQARPYAGKLKEMLASLSTKVDTSVNPLLSPREEVNNVLVI 80 
193214590  81 LVTSDRGLCGAFNTNIIKMAQRLIDQDYADMSRQGRVKMICAGRRGNDFFRKRGYNVVYGYPNIFNQLDFNAAKEIVEKA 160
189347804  81 LIAADRGLCGAFNTNIIKLAQKVVTEDYAAQYKNGGVSMICAGSRGFDFFRKRGFSIVKGYPSVFQNLDFSVAKEIAETA 160
145220430  81 LITSDRGLCGGFNTNIIKVAQRVVNNEYGELNAAGRLSMICAGTRGFDFFRKRGYTILKGYPSVFQNLDFSTAQEIAETA 160
119358311  81 LITADRGLCGAFNTNIVKLAYKLIHEDYAAQHSKNGVSLICAGSRGFDFFRKRGYNIIKGYPGVFQRLDFSFAKEIAETV 160
189499278  81 VITSDRGLCGAFNANIIKIAQKVVTEEHGDLYRDGKVEMLCAGSKGNDYFRKRGFSISKAYPGLFQNLHFSVAREIAEYA 160
78188124   81 LVTSDRGLCGAFNGNIIKLAYKTIHEDYAAQYGKGGVSMICAGTRGYEFFKKRHYTLTKGYPAVFQNLDFAVAKEIADMA 160
78187826   81 LITSDRGLCGAFNTNIIKLAHRTIHEEYAAAYAAGNVQLICAGTRGFDFFRKRGYSVLKGYPAVFQNLDFSTAREIAETA 160
194337685  81 LVTADRGLCGAFNTNAIKLASKIIHEDYPAIHSKGGVSLICAGSRGFDFFRKREYNIVKGYSAVFQHLDFSTAKEIADIA 160
194333107  81 LITSDRGLCGAFNTNIIKVAQKVMTVDHADLHKSGKVDLICAGSKGYDFFRKRDYRILKGYPGVFQNLDFSVAKEIAEQA 160
193213547  81 LVTSDRGLCGGFNANIMKLAQRVIHEDYAAQHAKGAVTMICAGTKGSDFFRKRGYNVTKAYPGVFQNLDFSSAKEIAELA 160
21674842   81 LVTSDRGLCGGFNANIIKMAQRLIHEEYAALHAKGGVTMICAGTKGTEFFRKRGYKLAAAYPGVFQNLSFDSAREIADKA 160
193214590 161 TELYLSGEVDKVHVIYNEFKNVVSPNLISEVFLPIAPSKKDDAGSDaarqnklvpivDYIYEPSPEAIINELVPKHLNTQ 240
189347804 161 SGMYLRGEADKVIVVYNEFKSVLAPVLKAEDLLPIAAENAGKDNSG-----------DYIYEPSPAVIIDELVPKHLSTQ 229
145220430 161 SSMYLKGEVDKVVVVYNEFKSVLAPVLKAETLLPISSEENEGDRGG-----------DYIYEPSPSAIISELVPKHLNTQ 229
119358311 161 SGMYLRGEADRVVVVYNEFKSVLAPVLKFETLLPITPEASGKDGGS-----------DYIYEPSPESIIDVLVPKHLNTQ 229
189499278 161 SERYLKGEVDKVVVVYNEFKSVLAPVLKSEVLLPITPEKVEGEKTGss--------iDYIYEPSPSAIIDVLVPKHLNTQ 232
78188124  161 SNMYLRGEVDRVVVVYNEFKSVLAPQLKSEVLLPITSGDASAKENSg---------gEYMYEPNPAAIIDVLLPKHLRTQ 231
78187826  161 SSMYVKGEVDRVVVVYNEFKSVLAPTLKAEVLLPIKSELPVAEGG------------DYIYEPSPAAIIEELVPKHLNTQ 228
194337685 161 SGMYLRGEVDRVLVAYNEFKSVLAPNLREEVILPIAPEIPGTESSS-----------DYIYEPSPSAIIDELVPKHLNTQ 229
194333107 161 SGMYLRGEVDKVVVVYNEFKSVLAPNLKSEVLLPITPEGSGDEGGS-----------DYIYEPSPASIIDVLVPKHLNTQ 229
193213547 161 SQMYLKGEADKVILVYNEFKSVLAPNLRTEQLLPIAPEEGTEEAAGs----------EYLYEPSPEAIIDELVPKHLNTQ 230
21674842  161 SKMYLSGEVDRVVLVYNEFKSVLAPNLRTEQLLPITPEGGDAKTASs----------EYLYEPSPAAIIDELVPKHLNTQ 230
193214590 241 LWRVLLESNAAEQASRMTAMDSATDNAKELLRSLSITYNRARQAAITKEILEIVGGANALEQ 302
189347804 230 VWRMMLESNAAEQAARMTAMDSATENAKELLRTLNISYNRARQAAITKELSEIVAGADALKN 291
145220430 230 VWRMMLESNAAEQAARMTAMDSATENAKELLRTLNISYNRARQAAITKELSEIVGGADALQN 291
119358311 230 VWRVMLESNAAEQAARMSAMDSATENAKELLRTLNISYNRARQAAITKELSEIVGGADALKG 291
189499278 233 IWRMMLESNAAEHASRMTAMDSATENAKELMRVLKISYNRARQAAITTELSEIVAGAEALQG 294
78188124  232 VWRIMLESNAAEQAARMAAMDSATENAKELLRTLNISYNRARQAAITTELSEIVAGAEALNG 293
78187826  229 VWGMMLESNAAEQAARMTAMDSATENAKELLRGLNISYNRARQAAITKELSEIVGGADALQN 290
194337685 230 IWRMMLESSAAEQAARMSAMDSATENAKELMRTLNISYNRARQAAITTELSEIVSGADALTN 291
194333107 230 VWRMMLESNAAEQAARMAAMDSATENAKELLRLLNISYNRARQAAITTELSEIVAGAEALQG 291
193213547 231 VWRVMLESNAAEQAARMAAMDSATENAKELIRVLNISYNRARQAAITKELSEIVAGADALKQ 292
21674842  231 LWRVMLESNAAEQAARMAAMDSATENAKELIRVLNISYNRARQAAITKELSEIVAGADALKQ 292
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap