Conserved Protein Domain Family
PRK13424

?
PRK13424: PRK13424 
F0F1 ATP synthase subunit gamma; Provisional
Statistics
?
PSSM-Id: 172047
View PSSM: PRK13424
Aligned: 10 rows
Threshold Bit Score: 525.851
Threshold Setting Gi: 94986846
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
220905449   1 MPSLKDVKMKIVGVGKTKQITKAMNMVASAKLRGAQARIERFRPYAAKYRDVLAELSSKVEGTAHPLLAEHEEKKHCAIV 80 
242280913   1 MASLKDVQNQIVSIKKTKQITKAMNMVASAKLRGAQDRIERFRPYADKFYEMLGDLAAGADSSVHPLLEVHEEIKTVGIV 80 
46579189    1 MPSLKDVKVKIAGVKKTKQITKAMNMVASAKLRGAQQRIERFRPYAEKFYGMLGDLASKADGSAHPLLEVRDEIKTCGIV 80 
218887915   1 MPSLKDVKVKIAGVKKTKQITKAMNMVASAKLRGAQQRIERFRPYAAKFYDMLGDLASKADSSVHPLLEVREEIKTCGIV 80 
120603237   1 MPSLKDVKVKIAGVKKTKQITKAMNMVASAKLRGAQQRIERFRPYAEKFYGMLGDLASKADGSAHPLLEVRDEIKTCGIV 80 
78356033    1 MPSLKDVQLKIAGVKKTKQITKAMNMVASAKLRGAQTRIERFRPYAAKFYEMLGDLASQADSSAHPLLEKREEVNTCGII 80 
239905118   1 MPALKDVKVKINAVRKTKQITKAMNMVASAKLRNAQSRIERFRPYADKFYEMLGELAKGADSSIHPLLEARAEVKTVLLV 80 
256831125   1 MASLRDIQNKIVGVKKTKQITKAMNMVASAKLRGAQGRIERFRPYADKFNDILIDLASRADASAHPLLEKREVIQNIGIV 80 
94986846    1 MASLKDVKIKIAGVRKTKQITKAMNMVASAKLRGAQIKIEHFRPYAEKFQDVISNLATRSDETVHKLLEKRTNGTSCIFI 80 
258406333   1 MPSLKDVKNKIAGVKKTKQITRAMNMVASAKLRRAQDRIVRFRPYAEKFYDILGDLSARADHDAHPLLEVREEIQNVGIV 80 
220905449  81 LVTSDRGLCGSFNGNIIAAALKLAREKTAEGLEVSFVCMGKKGRDAMKSCGYKITQAYADRMGSIDFALANSVAKEVIYG 160
242280913  81 LTTSDRGLCGSFNANMINAALKKAAEKKAEGKAVKFYCVGKKGAAAIKKTEYEIVEAYNDDMTHFDFNLAASIGNKVIDA 160
46579189   81 LATSDRGLCGSFNANLISTALKLAKQKAAEGKTVKFYCVGKKGRDTIRKADFEVVTAIADQMGSFDFQLANKLGLEVINH 160
218887915  81 LATSDRGLCGSFNSNLITTALKLAAKKAAEGKKVKFYCVGKKGRDAARKTDHEVAMALADQMGSFDFQLANRIGLDVINA 160
120603237  81 LATSDRGLCGSFNANLISTALKLAKQKAAEGKTVKFYCVGKKGRDTIRKADFEVVTAIADQMGSFDFQLANKLGLEVINH 160
78356033   81 LATSDRGLCGSFNVNLINDALRLAREKASAGKTVKFYCVGKKARDAVRKSEFEIVKELVGQMNAFDFTMANSIGLDVIHA 160
239905118  81 VITSDRGLCGAFNNNIINAALKVARAKTAEGKDVKIMCVGRKARDSFRRTSFEIVAAYVNEMAAFDFSLATRIGAEVIGG 160
256831125  81 LVTSDKGLCGSFNANLCNAANRLAKQKEAEGKTVKFICIGKKGRDFIRKTKFEITTAYAENMTHFDFQLASETGNLVIDG 160
94986846   81 LITSDRGLCGIFNTMLIIKALELAKQKTTKGKKVSFICIGRKGRDAIKKTHYPILSDYSDKFTR-DYQLASHISEKVIDG 159
258406333  81 LITSDKGLCGSFNMNLIQQALKLAEAKHNEGKSVTFYCVGKKGRDAVRKRGYTLATAHVDEMNVFDFSLANSIGTEVIDA 160
220905449 161 YETLALDEVWLIYGEFVSMGQQPPRSLCLLPLKTPEAEEiaeEAGEPRCEYVYEPQEEKLLAELLPRYVKVQIYRGMLDT 240
242280913 161 YLAEELDEVFLVFGEFVNVASQPPNTLQILPMSSDAAGEe--GESGANSEYIYEPSVEGLLAELLPRFVKVQVYRGLLDT 238
46579189  161 YLTGELDEVVLVYGEFVSTAKQLPITLPILPIASEKKDE---AEAAPSKEYIYEPAVEGLLAELLPRFIKVQIYRGLLDT 237
218887915 161 YLARELDEVIMVYGEFVSMAKQLPIALPILPIAPKEEEAa-pAAPASNKEYIYEPAVEGLLAELLPRFIKVQLYRGLLDT 239
120603237 161 YLTGELDEVVLVYGEFVSTAKQLPITLPILPIASEKKDE---AEAAPSKEYIYEPAVEGLLAELLPRFIKVQIYRGLLDT 237
78356033  161 YLTGELDEVVMIYGEFQSMVRQVPQRLQLLPMAAAKEEE----VAAPSKEYTYEPAVEGLLAELLPRFIKVQIYRGLLDT 236
239905118 161 YVGGTYDEVTMAFGKFISLARQEPTLLPVLPLSPAEAGEv-kEDVGAKAEYIYEPSVEGLLAELLPRFINVQIYRGLLDT 239
256831125 161 YLSGQFDEVHIVYGKFVNIARQEATSSQILPAETPEVEA----PAGASSEYIFEPSVEGLLAELLPRYVKVQMYRGLLDT 236
94986846  160 YLTVNMDEVVLIYGQFINAMRQIVGFSTLLPIHPKPLDK---EQLEKYSEYIYEPGVAILLSELLPKFVTTQIYRGFLDT 236
258406333 161 YLDGSLDEVHLVYGEFVTLIRQNPRQLQMLPIVTEGEAE----ETGAASEYIYEPSVEGLLAEILPRFIKVQVYRGLLDT 236
220905449 241 SASEHAARMTAMDNATRNCNEMTNMLTLLYNKTRQASITSELIDIVGGAEALKG 294
242280913 239 SCSEHAARMAAMDNASRACDDMTETLTLLYNKTRQAAITADLMDIVGGAEALKG 292
46579189  238 SASEHAARMAAMDNATRSCDDMIGALTLLFNKTRQASITRDLMDIVGGAEALKG 291
218887915 240 SASEHAARMAAMDNATRSCDDMIGSLTLLFNKTRQASITRDLMDIVGGAEALKG 293
120603237 238 SASEHAARMAAMDNATRSCDDMIGALTLLFNKTRQASITRDLMDIVGGAEALKG 291
78356033  237 SASEHAARMTAMDNATRSCDDMISSLTLLYNKTRQAAITRDLMDIVGGAEALKG 290
239905118 240 SASEHAARMRSMDNATRNCDDLVSSLTLVYNKARQTAITKELMDIVGGSEALKG 293
256831125 237 SASEHAARMSAMDNATKNCDEMVGSLTKVYNKARQSSITTQLMDIVGGAEALKG 290
94986846  237 DASENAARMTAMDNATRNCDELIGNLTRLYNKTRQASITSELIDIVSGAEALK- 289
258406333 237 SASEHAARMTAMDNATNNCDDMISSLTLVYNKTRQAAITTELMDIVGGAEALQ- 289
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap