Conserved Protein Domain Family
PRK13414

?
PRK13414: PRK13414 
flagellar biosynthesis protein FliZ; Provisional
Statistics
?
PSSM-Id: 139556
View PSSM: PRK13414
Aligned: 8 rows
Threshold Bit Score: 217.391
Threshold Setting Gi: 218249901
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119953075   5 TLFKFVFLIIFIFFFKNLFAQENGvDLDISSSSLENEVNLPIFEGDKANL-NNKDIQNISLFNISDLVTIFLFFLFFLIC 83 
15594621    1 MNNKFLFLVFLSFFNFFTYANSQE-QVNSASTDLENESSLPIFEEDKANFvNNDSTQPVSIFNISDLLKIVLFLLIAFFI 79 
218249901   1 MNNKFLFLVFLSFFNFFTYANSQE-QVNSASTDLENESSLPIFEEDKANFvNNDSTQPVSIFNISDLLKIVLFLLIAFFI 79 
187918150   5 TLFKFVFLIFFILISKSLFAQKNE-VEDVSTSSLESEVNLPIFEDNKADL-NNKDIQNISLLNVSDLVTIFLFFLAFLVC 82 
111115101   1 MNNKFLFLVFLAFSNFFTYANSQE-QINSVSTDLENESNLPIFEEDKANLaNNASAQPVSLFNISDLVKIVLFLLIAFFI 79 
203284197   1 MNRLILFFTFIVFFAENLFAQDNEsDLN-VTSKLENEVNLPIFDDNKVVL-DNQDIQSISLFNVTDLFTLVLFFLFFVIF 78 
203287736   1 MNRLILFFTFIVFFAENLFAQDNEsDLN-VTSKLENEVNLPIFDDNKVVL-DNQDIQSISLFNVTDLFTLVLFFLFFVIF 78 
51598536    1 MNNKFLFLVFLAFSNFFTYANSQK-QVNSVSVDLENESSLPIFEEDKANLaNNVSAQPVSLFNILDLVKIVLFLLIAFFI 79 
119953075  84 IFLFKKMILNHKKVKNSYKSNFIRELAFYEIDNKNSVRVINILGNVYVFLVSSNSSILLREIKQGEELDNLKFELDKAKS 163
15594621   80 FFLLKKLIFYSKKSKYEQNSNLIKELVFYEIDVKNSIRIINILDNVYIFLVSSNSFTLLKEIKSEEELEDLKLRLSKIND 159
218249901  80 FFLLKKLIFYSKKSKYEQNSNLIKELVFYEIDVKNSIRIIKILDNVYIFLVSSNSFTLLKEIKSEEELEDLKLRLSKIND 159
187918150  83 IFLLKKMLLNHKKIRNDDKSELIRELAFYEIDNKNSLRVINILGNIYVFLVSSNSSILLREIKRGEELDNWEFEFDKAKS 162
111115101  80 FFLFKKLIFYSKKSKYEQNSNLIKELVFYEIDVKNSIRIINILDNVYIFLVSSNSSILLKEVKSEEELEDLKLRLSKINN 159
203284197  79 IFLFKKMILSYKKNKNNDMSSLIRELAFYEIDNKNSIRIVNVLGNVYVFLVSNSSSIVLKEITTSEELENLEFQLNKIKS 158
203287736  79 IFLFKKMILSYKKNKNNDMSSLIRELAFYEIDNKNSIRIVNVLGNVYVFLVSNSSSIVLKEITTSEELENLEFQLNKIKS 158
51598536   80 FFLFKKLIFNSKKSKYEQSSNLIKELVFYEIDVKNSIRIINILDNVYIFLVSSNSSTLLKEIKSEEELEDLKLRLSKINN 159
119953075 164 LSDITSFKSIFNKILRknKKDE-LSFDKTEYAALENDIETSLKSKQDRLKKF 214
15594621  160 SAKKDSFQSIFKKMLL--KKEE-IPSSGNDYVKLEEKIEASLKDKQDRLKKF 208
218249901 160 SDKKDSFQSIFKKMLL--KKEE-IPSSGNDYVKLEEKIEASLKDKQDRLKKF 208
187918150 163 HSNVSSFKAIFDKILRkdQKNE-PSLDETEFAEVENDIETSLKSKQDRLKKF 213
111115101 160 SAKKDSFKSIFKKMLL--KKEE-IPFSRNDYVKLEKKIETSLKDKQDRLKKF 208
203284197 159 RGNINSFKSIFNKILRnnKKDKsFINDHDEYAELENDIETSLKSKQDRLKKF 210
203287736 159 RGNINSFKSIFNKILRnnKKDKsFINDHDEYAELENDIETSLKSKQDRLKKF 210
51598536  160 FAKKDSFKSIFKKMLL--KKED-IAFSGNDYVKLEKKIETSLKDKQDRLKKF 208
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap