Conserved Protein Domain Family
PRK13403

?
PRK13403: PRK13403 
ketol-acid reductoisomerase; Provisional
Statistics
?
PSSM-Id: 106361
View PSSM: PRK13403
Aligned: 19 rows
Threshold Bit Score: 639.101
Threshold Setting Gi: 49477403
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
163939692   1 MKTYYEKDANLELLKGKTVAVVGYGSQGHAQAQNLRDSGVEVVVGVRPGKSYEVAKADGFEVISVSEAVRTAQVVQMLLP 80 
42781005    1 MKTYYEKDANVELLKGKTVAVIGYGSQGHAQAQNLRDSGVEVVVGVRPGKSFEVAKTDGFEVMSVSEAVRTAQVVQMLLP 80 
30019921    1 MKTYYEKDANVELLQGKTVAVVGYGSQGHAQAQNLRDSGVEVVVGVRPGKSYEVAKADGFEVMSVSEAVRTAQVVQMLLP 80 
52143567    1 MKTYYEKDANVDLLQGKTVAVVGYGSQGHAQAQNLRDSGVEVVVGVRPGKSYEVAKADGFEVMSVSEAVRTAQVVQMLLP 80 
222095513   1 MKTYYEKDANVDLLQGKTVAVVGYGSQGHAQAQNLRDSGVEVVVGVRPGKSYEVAKADGFEVMSVSEAVRTAQVVQMLLP 80 
218232349   1 MKTYYEKDANVELLQGKTVAVIGYGSQGHAQAQNLRDSGVEVVVGVRPGKSYEVAKADGFEVMSVSEAVRTAQVVQMLLP 80 
217959374   1 MKTYYEQDANVELLKGKTVAVIGYGSQGHAQAQNLRDSGVEVVVGVRPGKSFEVAKADGFEVMSVSEAVRTAQVVQMLLP 80 
218903007   1 MKTYYEQDANVGLLQGKTVAVIGYGSQGHAQAQNLRDSGVEVVVGVRPGKSFEVAKADGFEVMSVSEAVRTAQVVQMLLP 80 
301053422   1 MKTYYEQDANVGLLQGKTVAVIGYGSQGHAQAQNLRDSGVEVVVGVRPGKSFEVAKADGFEVMSVSEAVRTAQVVQMLLP 80 
296502481   1 MKTYYEKDANVELLQGKTVAVVGYGSQGHAQAQNLRDSGVEVVVGVRPGKSYEVAKADGFEVMSVSEAVRTAQVVQMLLP 80 
163939692  81 DEQQAYVYKTEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
42781005   81 DEQQAHVYKAGVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
30019921   81 DEQQAHVYKAEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
52143567   81 DEQQAHVYKAEIEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
222095513  81 DEQQAHVYKAEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
218232349  81 DEQQAHVYKSEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVYQEGNGVPALVAVHQDATGTAL 160
217959374  81 DEQQAHVYKAEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
218903007  81 DEQQAHVYKAEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
301053422  81 DEQQAHVYKAEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
296502481  81 DEQQAHVYKAEVEENLREGQMLLFSHGFNIHFGQINPPSYVDVAMVAPKSPGHLVRRVFQEGNGVPALVAVHQDATGTAL 160
163939692 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
42781005  161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQTVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
30019921  161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
52143567  161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
222095513 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
218232349 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
217959374 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
218903007 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
301053422 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
296502481 161 HVALAYAKGVGCTRAGVIETTFQEETETDLFGEQAVLCGGVTALVKAGFETLTEGGYRPEIAYFECLHELKLIVDLMYEG 240
163939692 241 GLTNMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLAEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
42781005  241 GLTNMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
30019921  241 GLTTMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
52143567  241 GLTNMRHSISDTAEFGDYVTGSRIVTDGTKKEMKRVLTEIQQGEFAKKWILENQAGRPTHNAMKKAEQNHGLEKVGAELR 320
222095513 241 GLTNMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
218232349 241 GLTTMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
217959374 241 GLTNMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
218903007 241 GLTNMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGEELR 320
301053422 241 GLTNMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGEELR 320
296502481 241 GLTTMRHSISDTAEFGDYVTGSRIVTDETKKEMKRVLTEIQQGEFAKKWILENQAGRPTYNAMKKAEQNHQLEKVGAELR 320
163939692 321 EMMSWIKEPekKTLVKK 337
42781005  321 EMMSWIDAP--KELVKK 335
30019921  321 EMMSWIHAP--KELVKK 335
52143567  321 EMMSWIHAP--KELVKK 335
222095513 321 EMMSWIHAP--KELVKK 335
218232349 321 EMMSWIHAP--KELVKK 335
217959374 321 EMMSWIHAP--KELVKK 335
218903007 321 EMMSWIHAP--KELVKK 335
301053422 321 EMMSWIHAP--KELVKK 335
296502481 321 EMMSWIHAP--KELVKK 335
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap