Conserved Protein Domain Family
PRK13397

?
PRK13397: PRK13397 
3-deoxy-7-phosphoheptulonate synthase; Provisional
Statistics
?
PSSM-Id: 172030
View PSSM: PRK13397
Aligned: 17 rows
Threshold Bit Score: 518.031
Threshold Setting Gi: 225870972
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
225868074   2 GNDIIADFLNKGCQKSNFIVGPCAIESYQQIRQAAASAKALGYKYFRGGAYKPRTSSNSFQGLGLTGVTYLHEVCQEFSL 81 
195978591   2 GNDIIADFLNKGCQKSNFIVGPCAIESYQQIRQAAASAKALGYKYFRGGAYKPRTSSNSFQGLGLTGVTYLHEVCQEFSL 81 
251782976   1 MKDIMSDFRNQGCSKRNFIVGPCSIESYDHIRLAASSAKKLGYTYFRGGAYKPRTSPTSFQGLGLEGIKYLHDVCQEFDL 80 
28895495    1 MIDIMSDFQNKTCSKNNFIVGPCSIESYDHIRLAASSAKKLGYNYFRGGAYKPRTSAASFQGLGLQGIRYLHEVCQEFGL 80 
21910815    1 MIDIMSDFQNKTCSKNNFIVGPCSIESYDHIRLAASSAKKLGYNYFRGGAYKPRTSAASFQGLGLQGIRYLHEVCQEFGL 80 
139473417   1 MIDIMSDFQNKTCSKNNFIVGPCSIESYDHIRLAASSAKKLGYNYFRGGAYKPRTSAASFQGLGLQGIRYLHEVCQEFGL 80 
71904000    1 MIDIMSDFQNKTCSKNNFIVGPCSIESYDHIRLAASSAKKLGYNYFRGGAYKPRTSAASFQGLGLQGIRYLHEVCQEFGL 80 
94988921    1 MIDIMSDFQNKTCSKNNFIVGPCSIESYDHIRLAASSAKKLGYNYFRGGAYKPRTSAASFQGLGLQGIRYLHEVCQEFGL 80 
94992813    1 MIDIMSDFQNKTCSKNNFIVGPCSIESYDHIRLAASSAKKLGYNYFRGGAYKPRTSAASFQGLGLQGIRYLHEVCQEFGL 80 
94990921    1 MIDIMSDFQNKTCSKNNFIVGPCSIESYDHIRLAASSAKKLGYNYFRGGAYKPRTSAASFQGLGLQGIRYLHEVCQEFGL 80 
225868074  82 KAVSEIMSERQLEEAYDYLDIIQIGARNMQNFELLKVLSKIDKPILFKRGLMATIEEYLGALSYLQENGKQNIILCERGV 161
195978591  82 KAVSEIMSERQLEEAYDYLDIIQIGARNMQNFELLKVLSKIDKPILFKRGLMATIEEYLGALSYLQENGKQNIILCERGV 161
251782976  81 VSVSEIMSDSQLEEAYDYLDVIQVGARNMQNFEFLKTLAHVDKPILFKRGLMATIEEFMGALSYLQEAGKTNIILCERGI 160
28895495   81 LSVSEIMSERQLEEAYDYLDVIQVGARNMQNFEFLKTLSHIDKPILFKRGLMATIEEYLGALSYLQDTGKSNIILCERGI 160
21910815   81 LSVSEIMSERQLEEAYDYLDVIQVGARNMQNFEFLKTLSHIDKPILFKRGLMATIEEYLGALSYLQDTGKSNIILCERGI 160
139473417  81 LSVSEIMSERQLEEAYDYLDVIQVGARNMQNFEFLKILSHIDKPILFKRGLMATIEEYLGALSYLQDTGKSNIILCERGV 160
71904000   81 LSVSEIMSERQLEEAYDYLDVIQVGARNMQNFEFLKTLSHIDKPILFKRGLMATIEEYLGALSYLQDTGKSNIILCERGV 160
94988921   81 LSVSEIMSERQLEEAYDYLDVIQVGARNMQNFEFLKTLSHIDKPILFKRGLMATIEEYLGALSYLQDTGKSNIILCERGV 160
94992813   81 LSVSEIMSERQLEEAYDYLDVIQVGARNMQNFEFLKTLSHIDKPILFKRGLMATIEEYLGALSYLQDTGKSNIILCERGV 160
94990921   81 LSVSEIMSERQLEEAYDYLDVIQVGARNMQNFEFLKTLSHIDKPILFKRGLMATIEEYLGALSYLQDTGKSNIILCERGV 160
225868074 162 RGYDVETRNMLDIMAVPIIQQKVKLPIIVDVSHSTGRRNLLLPAAKAAKAIGANGIMMEVHPTPDLALSDAAQQIDYQQL 241
195978591 162 RGYDVETRNMLDIMAVPIIQQKVKLPIIVDVSHSTGRRDLLLPAAKAAKAIGANGIMMEVHPTPDLALSDAAQQIDYQQL 241
251782976 161 RGYDVETRNMLDIMAVPIIQQKTDLPIIVDVSHSTGRRDLLLPAAKVAKAVGANGIMMEVHPDPDHALSDAAQQINYDQL 240
28895495  161 RGYDVETRNMLDIMAVPIIQQKTDLPIIVDVSHSTGRRDLLLPAAKIAKAVGANGIMMEVHPDPDHALSDAAQQIDYKQL 240
21910815  161 RGYDVETRNMLDIMAVPIIQQKTDLPIIVDVSHSTGRRDLLLPAAKIAKAVGANGIMMEVHPDPDHALSDAAQQIDYKQL 240
139473417 161 RGYDVETRNMLDIMAVPIIQQKTDLPIIVDVSHSTGRRDLLLPAAKIAKAVGANGIMMEVHPDPDHALSDAAQQIDYKQL 240
71904000  161 RGYDVETRNMLDIMAVPIIQQKTDLPIIVDVSHSTGRRDLLLPAAKIAKAVGANGIMMEVHPDPDHALSDAAQQIDYKQL 240
94988921  161 RGYDVETRNMLDIMAVPIIQQKTDLPIIVDVSHSTGRRDLLLPAAKIAKAVGANGIMMEVHPDPDHALSDAAQQIDYKQL 240
94992813  161 RGYDVETRNMLDIMAVPIIQQKTDLPIIVDVSHSTGRRDLLLPAAKIAKAVGANGIMMEVHPDPDHALSDAAQQIDYKQL 240
94990921  161 RGYDVETRNMLDIMAVPIIQQKTDLPIIVDVSHSTGRRDLLLPAAKIAKAVGANGIMMEVHPDPDHALSDAAQQIDYKQL 240
225868074 242 EQLGKELWES 251
195978591 242 EQLGKELWES 251
251782976 241 DQLGRDLWQD 250
28895495  241 EQLGQELWQD 250
21910815  241 EQLGQELWQD 250
139473417 241 EQLGQELWQD 250
71904000  241 EQLGQELWQD 250
94988921  241 EQLGQELWQD 250
94992813  241 EQLGQELWQD 250
94990921  241 EQLGQELWQD 250
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap