Conserved Protein Domain Family
PRK13390

?
PRK13390: PRK13390 
acyl-CoA synthetase; Provisional
Statistics
?
PSSM-Id: 139538
View PSSM: PRK13390
Aligned: 4 rows
Threshold Bit Score: 1067.32
Threshold Setting Gi: 120401043
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108801612   1 MYPGTHAQIAPDRPAVIVAETGEQVSYRQLDDDSAALARVLYDAGLRTGDVVALLSDNSPEALVVLWAALRSGLYITAIN 80 
126437596   1 MYPGTHAQIAPDRPAVIVAETGEQVSYRQLDDDSAALARVLYDAGLRTGDVVALLSDNSPEALVVLWAALRSGLYITAIN 80 
119870766   1 MYPGTHAQIAPDRPAVIVAETGEQVSYRQLDDDSAALARVLYDAGLRTGDVVALLSDNSPEALVVLWAALRSGLYITAIN 80 
120401043   1 MYPGTHARTAPERAAVVVAETGETLSYRRLDEQSAALARVLHDAGLRPGDVVVLLSDNAPEALVVLWAAQRSGLYVTAIN 80 
108801612  81 HHLTAPEADYIVGDSGARVLVASAAL----DGLAAKVGADLPLRLSFGGEIDGFGSFEAALAGAGPRLTEQPCGAVMLYS 156
126437596  81 HHLTAPEADYIVGDSGARVLVASAAL----DGLAAKVGADLPLRLSFGGEIDGFGSFEAALAGAGPRLTEQPCGAVMLYS 156
119870766  81 HHLTAPEADYIVGDSGARVLVASAAL----DGLAAKVGADLPLRLSFGGEIDGFGSFEAALAGAGPRLTEQPCGAVMLYS 156
120401043  81 HHLTPAEAGYIVCDSGARALVASAALrelaDGVVAEAGGP-EVRIAFGGRIDGFADYESTLAAAGPPLAEQPCGAVMLYS 159
108801612 157 SGTTGFPKGIQPDLPGRDVDAPGDPIVAIARAFYDISESDIYYSSAPIYHAAPLRWCSMVHALGGTVVLAKRFDAQATLG 236
126437596 157 SGTTGFPKGIQPDLPGRDVDAPGDPIVAIARAFYDISESDIYYSSAPIYHAAPLRWCSMVHALGGTVVLAKRFDAQATLG 236
119870766 157 SGTTGFPKGIQPDLPGRDVDAPGDPIVAIARAFYDISESDIYYSSAPIYHAAPLRWCSMVHALGGTVVLAKRFDAQATLG 236
120401043 160 SGTTGFPKGIRPDLPERSVDQPGDPVVAIAGGLFGITSSDVYFSSAPIYHAAPLRWCGMVHALGGTVVLAKRFDAADTLR 239
108801612 237 HVERYRITVTQMVPTMFVRLLKLDADVRTRYDVPSLRAVIHAAAPCPVDVKHAMIDWLGPIVYEYYSSTEAHGMTFIDSP 316
126437596 237 HVERYRITVTQMVPTMFVRLLKLDADVRTRYDVSSLRAVIHAAAPCPVDVKHAMIDWLGPIVYEYYSSTEAHGMTFIDSP 316
119870766 237 HVERYRITVTQMVPTMFVRLLKLDADVRTRYDVPSLRAVIHAAAPCPVDVKHAMIDWLGPIVYEYYSSTEAHGMTFIDSP 316
120401043 240 YIEKFRITATQMVPTMFVRMLKLNDEVRSRYDLSSLRGVIHAAAPCPVDVKQAMIDWLGPIIWEYYSSTEVHGMTVIDTG 319
108801612 317 DWLAHPGSVGRSVLGDLHICDDDGNELPAGRIGTVYFERDRLPFRYLNDPEKTAAAQHPAHPFWTTVGDLGSVDEDGYLY 396
126437596 317 DWLAHPGSVGRSVLGDLHICDDEGNELPAGRIGTVYFERDHLPFRYLNDPEKTAAAQHPAHPFWTTVGDLGSVDEDGYLY 396
119870766 317 DWLAHPGSVGRSVLGDLHICDDDGNELPAGRIGTVYFERDRLPFRYLNDPEKTAAAQHPAHPFWTTVGDLGSVDEDGYLY 396
120401043 320 QWLSHQGSVGRSVLGTLHICDDDGHDLPAGEVGTVYFERDALPFSYHNAPEKTAEAQHPAHPFWTTVGDLGYVDDEGYLY 399
108801612 397 LADRKSFMIISGGVNIYPQETENALTMHPAVHDVAVIGVPDPEMGEQVKAVIQLVEGIRGSDELARELIDYTRSRIAHYK 476
126437596 397 LADRKSFMIISGGVNIYPQETENALTMHPAVHDVAVIGVPDPEMGEQVKAVIQLVEGIRGSDELARELIDYTRSRIAHYK 476
119870766 397 LADRKSFMIISGGVNIYPQETENALTMHPAVHDVAVIGVPDPEMGEQVKAVIQLVEGIRGSDELARELIDYTRSRIAHYK 476
120401043 400 LADRKAFMIISGGVNIYPQEVENALTLHPAVHDVAVIGVPDPEMGEQVKAVVHLTAGVDPSEELARELIDYTRARIAHYK 479
108801612 477 APRSVEFVDELPRTPTGKLVKGLLR 501
126437596 477 APRSVEFVDELPRTPTGKLVKGLLR 501
119870766 477 APRSVEFVDELPRTPTGKLVKGLLR 501
120401043 480 APRSVDFVDDLPRTPTGKLVKGKLR 504
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap