Conserved Protein Domain Family
PRK13384

?
PRK13384: PRK13384 
porphobilinogen synthase
Statistics
?
PSSM-Id: 172020
View PSSM: PRK13384
Aligned: 19 rows
Threshold Bit Score: 582.08
Threshold Setting Gi: 169633211
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
77459973    1 MSSQFPEARPRRLRRNASLRSLFQETEFSLNDLVLPIFVEEEIDDFVPIKSMPGVMRIPERKLAGEIERYARAGIKSVMT 80 
160875007   1 MLNTPPLRRLRRLRSSEAMRDLLRETHISLSDLIHPLFIEEHITHAVPISTLPGISRLPETALAEEVRELYALGIRYVMP 80 
153000410   1 MLNTPPLRRLRRLRSSEAMRDLLRETHISLSDLIHPLFIEEHITHAVPISTLPGISRLPESALADEVRELYALGIRYVMP 80 
217973601   1 MLNTPPLRRLRRLRSSEAMRDLLRETHISLSDLIHPLFIEEHITHAVPISTLPGISRLPESALADEVRELYALGIRYVMP 80 
91791670    7 TSGSRLIKRLRRLRSSPNMRELVREYEVKLSDLIYPIFIEENITNPVPITSLPGLVRIPEAQLGAEIEALNALGIRYVMP 86 
70729658   32 MSSQFPEARPRRLRRSEQLRSLFQETEFTLNDLVLPIFVEEEIDDFVPIKSMPGVMRIPESRLAGEIERYARAGIKSVMT 111
170740661   1 MTAHFPLRRPRRLRRTSAMRSLVRETSLSSHDLIYPVFVEEGITDPIPIPTMPGITRVPERMLAREIARLAADGLRAVIL 80 
169633211   2 SKMKSPILRLRRLRRTKAIRGLLCENNFSVEDLVQPIFIEESITQPIPISTMPGIYRLPEQDIEQEVKALYALGIRCVMP 81 
115522305   2 MVAGFPIVRPRRLRRTEALRHLVRETSVGAQDLIYPIFVEEQIDDAVPIATMPGVCRIPERKLAAEIEQIARDGIKAVLL 81 
90421695    1 MVAAFPIVRPRRLRRSEALRQLVRETRVCAHDLIYPIFVEEQIDDAVPIATMPGVLRIPERKLAAEIERIARDGVKAVLL 80 
77459973   81 FGVSHHLDANGSDTWRENGLVSRMSRIAKDAVPDMIVMSDTCFCEYTDHGHCGVMHNHEVDNDQTLINLGKQAVAAARAG 160
160875007  81 FGISHTKDDKGSDTWDDNGLLARMVRTIKAAVPEMMVIPDICFCEYTDHGHCGVVHNNEVCNDLTVENLVKQSVTAAKAG 160
153000410  81 FGISHTKDDKGSDTWDDNGLLARMVRTIKAAVPEMMVIPDICFCEYTDHGHCGVVHNNEVCNDLTVENLVKQSVTAAKAG 160
217973601  81 FGISHTKDDKGSDAWDDNGLLARMVRTIKAAVPEMMVIPDICFCEYTDHGHCGVVHNNEVCNDLTVENLVKQSVTAAKAG 160
91791670   87 FGISHHKDNCGSDTWNSKGLLARMISTIKTVCPNMMVIPDICFCEYTTHGHCGVLKQQSIDNDATVENLVKQCINAARAG 166
70729658  112 FGVSHHLDCDGSDTWKENGLVSRMSRIAKDAVPEMIVMSDTCFCEYTDHGHCGVMHGHEVDNDQTLLNLGKQAVAAARAG 191
170740661  81 FGISHRKDAHGSDTWDPNGLMARMVRIAKREVPDLIVITDNCFCEYTHHGHCGVYREGQVDNDATLTNLGRQARVAIEAG 160
169633211  82 FGISHHKDSMGSDTWSDTGLLVRMIKAIKSSCPEMIVTPDICFCEYTTHGHCGVMIHDQISNDLTVENLIKQSLAAAKAG 161
115522305  82 FGISHHKDAAGSDSWNPDGLMARMVRIAKAAVPELVVITDNCFCEYTILGHCGTLRGGAVDNDATLLNLGRQAVVAIEAG 161
90421695   81 FGISHHKDAIGSDSWNPDGLMARMVRIAKAAAPELVVITDNCFCEYTLHGHCGSLRGDSVDNDATLLNLGRQAVVAIEAG 160
77459973  161 ADVIAPSAAMDGQVRAIRRALDDAGFSQIPIMAYSTKFASALYGPFREAGGSALKGDRKSYQMNPMNRREALRESLLDEQ 240
160875007 161 ADMLAPSAMMDGQVKAIRQGLDAAGFEHVAILAHSAKFASSFYGPFRAAVDCELSGNRKGYQLDYANGRQALLEASLDEA 240
153000410 161 ADMLAPSAMMDGQVKAIRQGLDAAGFEHVAILAHSAKFASSFYGPFRAAVDCELSGNRKGYQLDYANGRQALLEASLDEA 240
217973601 161 ADMLAPSAMMDGQVKAIRQGLDATGFEHVAILAHSAKFASSFYGPFRAAVDCELSGNRKGYQLDYANGRQALLEASLDEA 240
91791670  167 ADMLAPSAMMDGQVMAIRQGLDKEGFSHVAILAHAAKFASSFYGPFRDAVACELKGDRHTYQLDYANSRQALHEAMLDEQ 246
70729658  192 ADVIAPSAAMDGQVQAIRRALDAAGFTQTPIMAYSTKFASALYGPFREAGGSALKGDRKSYQMNPMNRREAVRESLLDEQ 271
170740661 161 ADMVAPSAMMDGQVAAIRRALDEGGHHDAPILAYSSKFASAFYGPFRAAAACEPIGDRSSYQMDPANGREALLESLLDEA 240
169633211 162 ADMLAPSGMMDGQVGAIREALDQAGYHNVLIMAHAIKFASALYGPFRVAVDSNLVGDRHSYQLDYANTRQALREAALDES 241
115522305 162 ADMVAPSAMMDGQIQAMRTALDKAGHSEAPIMAYSSKFASALYGPFRVAAGSELKGDRRSYQMDPMNGREALRESALDEA 241
90421695  161 ADMVAPSAMMDGQIQAMRTALDEAGHCEAPILAYSSKFASALYGPFRVAAGSELEGDRRSYQMDPMNGREALRESALDEA 240
77459973  241 EGADALMVKPAGAYLDIIRDIREASTLPLAAYQVSGEYAMIKFGAQAGAIDEDRVVRESLGAIKRAGADLIFTYFAMDLA 320
160875007 241 EGADILMVKPGTPYLDVLSRLRQETHLPLAAYQVGGEYAGIKFAALAGALDERAVVTETFVGLKRAGADLIVSYYTKQYA 320
153000410 241 EGADILMVKPGTPYLDVLSRLRQETHLPLAAYQVGGEYAGIKFAALAGALDERAVVTETFVGLKRAGADLIVSYYTKQYA 320
217973601 241 EGADILMVKPGTPYLDVLSRLRQETHLPLAAYQVGGEYAGIKFAALAGALDERAVVTETFVGLKRAGADLIVSYYTKQYA 320
91791670  247 EGADILMIKPGTPYLDILSTLRSNTLLPLAAYQVSGEYAVIKCAANIGVLNERATVLETLTGFKRAGADLIVTYYAKQFA 326
70729658  272 EGADSLMVKPAGAYLDIIRDIREASRLPVAAYQVSGEYAMIKFGAQAGAIDEPRVVRETLGSIKRAGADLIFTYFAMDLA 351
170740661 241 EGADMLMVKPGLAYLDVLTRLRDRTPLPLVSYQVGGEYAMIKFAADAGALDEAATVRESLLAMKRAGATLIVSYYAHRAV 320
169633211 242 EGADLLIVKPGMFYLDILSQLRAQTKLPLAAYQVGGEYAAIKFAAIAKALDERKTVIESITAFKRAGADVIITYFAKDIA 321
115522305 242 EGADLLMVKPALAYLDVLAALRARTELPLVGYQVGGEYAMIKFAALAGALDEAATVRETLGAIKRAGADLIISYFARDIA 321
90421695  241 EGADLLMVKPALAYLDVLAALRARTELPLVAYQVGGEYAMIKFAAMAGALDEAATVRETLGAIKRAGADLIISYFARDIA 320
77459973  321 LagI 324
160875007 321 Q--W 322
153000410 321 Q--W 322
217973601 321 Q--W 322
91791670  327 Q--W 328
70729658  352 LagI 355
170740661 321 KdgW 324
169633211 322 I--W 323
115522305 322 RegW 325
90421695  321 RdgW 324
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap