Conserved Protein Domain Family
PRK13383

?
PRK13383: PRK13383 
acyl-CoA synthetase; Provisional
Statistics
?
PSSM-Id: 139531
View PSSM: PRK13383
Aligned: 4 rows
Threshold Bit Score: 961.377
Threshold Setting Gi: 118619872
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118464228   1 MAPTAARALVRSGLLNPPSPRAVLRLLREASRGGTNPYTLLAVTAARWPGRTAIIDDDGALSYRELQRATESLARRLTRD 80 
41409595    6 VAPTAARALVRSGLLNPPSPRAVLRLLREASRGGTNPYTLLAVTAARWPGRTAIIDDDGALSYRELQRATESLARRLIRD 85 
183980327   6 VVTTAARALLGSGLLSPSSPAAALRLVRELYRGGTNLYTPLAIAAARWPERTAIVDDDGALSYREIQTMTESVAGELTLA 85 
118619872   6 VVTTAARALLGSGLLSPSSPAAALRLVRELYRGGTNLYTPLAIAAARWPERTAIVDDDGALSYREIQTMTESVAGELTLA 85 
118464228  81 GVAPGRAVGVMCRNGRGFVTAVFAVTLLGADVVPISTEFRSDALAAALRAHHISTVVADNEFAERIAAADDAVAVIDPAT 160
41409595   86 GVAPGRAVGVMCRNGRGFVTAVFAVALLGADVVPISTEFRSDALAVALRAHHISTVVADNEFAERIAGADDAVAVIDPAT 165
183980327  86 GIGPGQAVGVMCRNGRNFVAAAFAAGLVGADVVLVNTEFRATALAAALEAHQMRVMLCDDEFVDQVAGTGESVLVIDPST 165
118619872  86 GIGPGQAVGVMCRNGRNFVAAAFAAGLVGADVVLVNTEFRATALAAALEAHQMRVMLCDDEFVDQVAGTGESVLVIDPST 165
118464228 161 AGAEESGGRPAVAAPGRIVLLTSGTTGKPKGVPRAPQLRSAVGVWVTILDRTRLRTGSRISVAMPMFHGLGLGMLMLTIA 240
41409595  166 AGAEESGGRPAVAAPGRIVLLTSGTTGKPKGVPRAPQLRSAVGVWVTILDRTRLRTGSRISVAMPMFHGLGLGMLMLTIA 245
183980327 166 VTARDC-ARPKVAPSGRIVLLTSGTTGVPKGVPRKPKVSSGIGVSVTLLERTRLRVGSRMTLATPMFHGLGFGMLVLTIS 244
118619872 166 VTARDC-ARPKVAPSGRIVLLTSGTTGVPKGVPRKPKVSSGIGVSATLLERTRLRVGSRMTLATPMFHGLGFGMLVLTIS 244
118464228 241 LGGTVLTHRHFDAEAALAQASLHRADAFTAVPVVLARILELPPRVRARNPLPQLRVVMSSGDRLDPTLGQRFMDTYGDIL 320
41409595  246 LGGTVLTHRHFDAEAALAQASLHRADAFTAVPVVLARILELPPRVRARNPLPQLRVVMSSGDRLDPTLGQRFMDTYGNIL 325
183980327 245 LGGTVLTRRHFDAEATLAQTSLHRADGLSVVPIMLARILDLPDQVRARNPLPCLRVVISSGDRLDPSLARRFMEAYGDVL 324
118619872 245 LGGTVLTRRHFDAEATLAQTSLHRADGLSVVPIMLARILDLPDQVRARNPLPCLRAVISSGDRLDPSLARRFMEAYGDVL 324
118464228 321 YNGYGSTEVGIGALATPADLRDAPETVGKPVAGCPVRILDRNNRPVGPRVTGRIFVGGELAGTRYTDGGGKAVVDGMTST 400
41409595  326 YNGYGSTEVGIGALATPADLRDAPETVGKPVAGCPVRILDRNNRPVGPRVTGRIFVGGELAGTRYTDGGGKTVVDGMTST 405
183980327 325 YNLYGSTEVGIGALATPAELRDWPETVGRPVAGCPVRIFDRNGRPVGPRVTGRIFVGGELNSDGYSGGGGKAVIDGMAST 404
118619872 325 YNLYGSTEVGIGALATPAELRDWPETVGRPVAGCPVRIFDRNGRPVGARVTGRIFVGGELNSDGYSGGGGKAVIDGMAST 404
118464228 401 GDMGYLDNAGRLFIVGREDDMIISGGENVYPRAVENALAAHPAVADNAVIGVPDERFGHRLAAFVVLHPGSGVDAAQLRD 480
41409595  406 GDMGYLDNAGRLFIVGREDDMIISGGENVYPRAVENALAAHPAVADNAVIGVPDERFGHRLAAFVVLHPGSGVDAAQLRD 485
183980327 405 GDMGYLDESGRLYIVGREDDMIVSGGENVYPRSLENALASHPDVAENAVIGVADEQFGQRLAAFVVARPGCDIDADAIRD 484
118619872 405 GDMGYLDESGRLYIVGREDDMIVSGGENVYPRSLENALASHPDVAENAVIGVADEQFGQRLAAFVVARPGCDIDADAIRD 484
118464228 481 YLKDRVSRFEQPRDINIVASIPRNPTGKVLRKELPG 516
41409595  486 YLKDRVSRFEQPRDINIVSSIPRNPTGKVLRKELPG 521
183980327 485 YLKGRVSRFEQPRDIHLVSSIPRNPAGKVLRKQLAS 520
118619872 485 YLKGRVSRFEQPRDIYLVSSIPRNPAGKVLRKQLAS 520
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap