Conserved Protein Domain Family
PRK13382

?
PRK13382: PRK13382 
bile acid CoA ligase
Statistics
?
PSSM-Id: 172019
View PSSM: PRK13382
Aligned: 21 rows
Threshold Bit Score: 856.75
Threshold Setting Gi: 172041365
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
68535363    8 QLPKPSLTDQIGTAGTLLkgtlplfKSGVLGSMGPVAAGKALKGIIQWSFLPAGLLAIGAARDPYHTAIIDDAGSMTYQE 87 
120401258   1 MGITDPVTKTLGLLSTMV-------RAGVIAPMRPDKYLRIAGAMQRENMAITSGFAAAAQRCPDRAGLIDELGILTWRQ 73 
120405179   1 ------MADPLGLLATLW-------RARLIAPMRPDRYLRMGLAMRRAGLTATVGFAAAAQRCPDLPGIIDELGTLTWKQ 67 
108800723   6 GDTAAKVGASVGLMQTLW-------RSRLIAPMRPDRYLKMGAAVRRVGMTATVGFATAAQRCPDRPGLIDERGMLTFAE 78 
126436346   6 GDTAAKVGASVGLMQTLW-------RSRLIAPMRPDRYLKMGAAVRRVGMTATVGFATAAQRCPDRPGLIDERGMLTFAE 78 
126436699   1 --MMNRLRKTAGIVGTMY-------RARVIAPLRPDRYLRMGAAVRRAGMSVTTGFALAAQRCPDRPGLIDELGTLTWRE 71 
119869862   6 GDTAAKVGASVGLMQTLW-------RSRLIAPMRPDRYLKMGAAVRRVGMTATVGFATAAQRCPDRPGLIDERGMLTFAE 78 
118470076   5 DRITDPLIDTVGMVTTMR-------RAGLIAPLRPDKYLRIVAAMARENMSVTSGFASAAQRCPDRPGLVDELGTLTWRE 77 
145221039   1 MGITDPVTNALGLISTMM-------RAGVIAPMRPDKYMRIVGAMQRENMAITSGFAAAAQRCPDRAGLVDELGILTWRQ 73 
145223014   1 ---MSSAADQFGLLATLW-------RARLIAPMRPDRYLRMGLAMRRAGLTATVGFAAAAQRCPDRPGIIDELGTLTWKQ 70 
68535363   88 LHEQSTALAQALFRTGIRERDRIGVLCRNHRGFILTLCAHGRLGTDIVLFNTGASAKQTQAVLQEQK---IDILFIDEEF 164
120401258  74 IDQRADAFAAALQALPGGQPEVIALMARNHRGFVDALIAANRIGADVLLLNTSFAGPALAEVMEREGegrSVAVVYDEEF 153
120405179  68 LDDRCDALAAALQK---HTPRTVAVMCRNHRGFVEALVGANRIGADVLLLNTSFAGPAMAEVIEREG---ADIVIYDQEF 141
108800723  79 LDDASDALAVALQGLPGGTPGTVAIMCRNHRGFIEALLAANRIGANALLLNTSFAGPALAEVAEREG---ADVVIYDEEF 155
126436346  79 LDDASDALAVALQGLPGGTPGTVAIMCRNHRGFIEALLAANRIGANALLLNTSFAGPALAEVAEREG---ADVVIYDEEF 155
126436699  72 LDSHSDALAAALQTLPGGQPEVVGIMARNHRGFVEALVAANRIGADVLLLNTSFAGPALADVVAREQ---VDAVIYDEEF 148
119869862  79 LDDASDALAVALQGLPGGTPGTVAIMCRNHRGFIEALLAANRIGANALLLNTSFAGPALAEVAEREG---ADVVIYDEEF 155
118470076  78 IDQQADALAAGLQALSGGAPRVLGIMARNHRGFVLSLIAANRIGADVLLLNTSFSGPALAEVVSREK---VDAVIYDEEF 154
145221039  74 IDQRADALAAALQALPEGQPEVIGLMARNHRGFVDSLIAANRIGADVLLLNTSFAGPALAEVLQREGegrAVAVIYDEEF 153
145223014  71 LDDRCDALGVALQK---EKPKTVAVMCRNHRGFVEALVAANRIGADVLLLNTSFAGPAMAEVVEREG---ADIVIYDQEF 144
68535363  165 LPLLPKDFDACPvvvawengdtlgltreaeealkkasnvrdaidsgdYATRSEDWPS--------LHEVLSTTPENLSIP 236
120401258 154 TDTVDRALAGRP-----------------------------------DTTRIVAWTDtpg--drlTVEGMIAEHGGQEPV 196
120405179 142 TATVDRALRDVP-----------------------------------GTTRILAWTDadd--gstTLEALIDAHLGQRPE 184
108800723 156 SETVERALSGLP-----------------------------------DAVRIIAWTDepgggaetTVDALIEAHRGERPR 200
126436346 156 SETVERALSGLP-----------------------------------DAVRIIAWTDepgggaetTVDALIEAHRGERPR 200
126436699 149 APSVAQALKDRP-----------------------------------KAAKIVAWTDdpda-qavTVAGLIDGHIGQRPL 192
119869862 156 SETVERALSGLP-----------------------------------DAVRIIAWTDepgggaetTVDALIEAHRGERPR 200
118470076 155 TDTVDRALAGAPe----------------------------------APTRIVAWTDtaa--hdvTVAALTEKFAGRQPQ 198
145221039 154 TETVDRAVADRP-----------------------------------ETTRILAWTDsdt--dalTVEGLIAEHGGQEPV 196
145223014 145 TETVDRALADTC-----------------------------------GARRIVAWVDdpaqagtaTVEALIDAHLGQRPQ 189
68535363  237 ARPRQGRTIILTSGTTGTPKGARRPE-PKTYMPASSIMSRIPMRHHRPSFLSAPMFHTWGFAQIQLALALRNTMIMQRRF 315
120401258 197 RAPEKSRVILLTSGTTGTPKGASHSG--GDPSVLKAILDRTPWRAEQPVVIVAPMFHAWGFSQLAFAASMSCTIVTRRRF 274
120405179 185 PATRKSDIILLTSGTTGTPKGAKRSAgSGGASDLKAVLDRTPWRAGEPIVIAAPMFHAWGFSQLLFAALLACPIVTRRKF 264
108800723 201 PAERSSEIILLTSGTTGTPKGAKRSAgSGGAGDLKAVLDRTPWRAEETTVIVAPMFHAWGFSQLLFAGLLACTIVTRRRF 280
126436346 201 PAERSSEIILLTSGTTGTPKGAKRSAgSGGAGDLKAVLDRTPWRAEETTVIVAPMFHAWGFSQLLFAGLLACTIVTRRRF 280
126436699 193 PSDRTSKLILLTSGTTGSPKGARHSG--GGADALKSILDRTPWRAEEVTVIVAPMFHAWGFGQLVFAAMMACTIVTRRKF 270
119869862 201 PAERSSEIILLTSGTTGTPKGAKRSAgSGGAGDLKAVLDRTPWRAEETTVIVAPMFHAWGFSQLLFAGLLACTIVTRRRF 280
118470076 199 RGGQKSKVILLTSGTTGTPKGAKHSG--GGPEILKAILDRTPWRAEEPVVIVAPMFHAWGFSQLAFAASMACTIITRRKF 276
145221039 197 RSVEKARVILLTSGTTGTPKGAKHSG--GDPGVLKSILDRTPWRAEQPVVIVAPMFHAWGFSQLAFAASMSCTIITRRKF 274
145223014 190 PATRKSDVILLTSGTTGSPKGAKRSAgSGGSGDLKAVLDRTPWRAEEPIVIAAPMFHAWGFSQLLFAALLACPIVTRRKF 269
68535363  316 SPEAAVKLIEKNRPYTIAMVPTMLRRMLEVVPENFNS----GTKIIATSGEALPPKVVRETQEKFGDVLYNLYGSTEVSW 391
120401258 275 DPEATLELVDKYRATGLCVVPVMFDRIMDLPDEVLDKysgrSLRFAAASGSRMRPDVVIKFMDRFGDVIYNNYNATEAGM 354
120405179 265 DPEATLALIDRHRATGLAVVPVMFDRIMELPAEVRNRysgrSLRFATASGSRMRPDVVTAFMDQFGDVIYNNYNATEAGM 344
108800723 281 DPEATLALVDEHKATGLIVVPVMFDRIMDLPDEVRARysgrSLRFAAASGSRMRPDVVTAFMDQFGDVIYNNYNATEAGM 360
126436346 281 DPEATLALVDEHKATGLIVVPVMFDRIMDLPDEVRARysgrSLRFAAASGSRMRPDVVTAFMDQFGDVIYNNYNATEAGM 360
126436699 271 DPEATLALVDEHRATGLCLVPVMFDRIVDLPEDVLSRysgrTLRFAAASGSRMRPDVVIKFMDRFGDVIYNNYNATEAGM 350
119869862 281 DPEATLALVDEHKATGLIVVPVMFDRIMDLPDEVRARysgrSLRFAAASGSRMRPDVVTAFMDQFGDVIYNNYNATEAGM 360
118470076 277 DPEATLELVDRHRATGLCVVPVMFDRIMELPEDVLNRydgrSLRFAAASGSRMRPDVVIAFMDRFGDVIYNNYNATEAGM 356
145221039 275 DPEATLELVDKFRATGLCVVPVMFDRIMELPEEVLDKysgrSLRFAAASGSRMRPDIVIKFMDRFGDVIYNNYNATEAGM 354
145223014 270 DPAATLALVDKYRATGLAVVPVMFDRIMDLPDEVRNRysgrSLRFATASGSRMRPDVVTAFMDQFGDVIYNNYNATEAGM 349
68535363  392 ASIATPEELRKHINTAGKPPMATTLKVLDDNGQELPNGEIGRIFVKNDMLFEGYTrPGSDKEIIDGMVATGDLGYYNDeG 471
120401258 355 IATATPRDLRAAPDTAGRPAEGTEIRILDADFNEVPTGEVGGIYVRNSTQFDGYT-TGKTKDFHEGFMSSGDVGYFDEaG 433
120405179 345 IATATPADLRAAPDTAGRAADGTELRILDAEHRDVPTGEVGQIFVRSSTLFDGYT-SGTTKAFHDGFMASGDMGYLDGaG 423
108800723 361 IATATPADLRAAPDTAGTPADGTEIRIFDPDFRELPPGETGSIFVRSGTLFDGYT-SGSTKDFHDGFMASGDVGYLDEnG 439
126436346 361 IATATPADLRAAPDTAGTPADGTEIRIFDPDFRELPPGETGSIFVRSGTLFDGYT-SGSTKDFHDGFMASGDVGYLDEnG 439
126436699 351 IATATPEDLRAAPDTAGKAAEGTDIRILDSDFHEQPRGEVGTIYVRNSSQFDGYT-SGANKNFHDGYMSSGDVGYLDEaG 429
119869862 361 IATATPADLRAAPDTAGTPADGTEIRIFDPDFRELPPGETGSIFVRSGTLFDGYT-SGSTKDFHDGFMASGDVGYLDEnG 439
118470076 357 IATATPADLRAAPDTAGRPAEGTEIRILDGDLRDLPTGEVGTIYVRNSTQFDGYT-SGTTKDFHEGFMCSGDVGRLDDaG 435
145221039 355 IATATPRDLRAAPDTAGRPAEGTEIKILDSEFNEVPTGETGGIWVRNSTQFDGYT-SGSTKDFHDGFMSSGDVGYLDEeG 433
145223014 350 IATATPEDLRAAPDTAGKAADGTELRILDAEHRELPTGEVGQIFVRSGTLFDGYT-SGSTKDFHDGFMASGDLGYLDDaG 428
68535363  472 LLFISGRSDDMIVSGGENVFPQETEDVINSMDCVAESAVRGVEDPEFGQALCVWVVPEGKSaaeltdeekAEFEQKAKTE 551
120401258 434 RLFVVGRDDEMIVSGGENVYPIEVEKTLAAHPDVAEATVLGVDDEKFGQRLEAFVVLTADA---------AATPETLKQH 504
120405179 424 RLFVVGRDDEMIVSGGENVYPIEVEKTLTTHAAVAEAAVLGVDDEQYGQRLAAFVVPAAGA---------SVTVEELKQH 494
108800723 440 RLFVVGRDDEMIVSGGENVYPIEVEKTLAAHPGVAEAEVLGVDDEKYGQRLAAFVVPAAGA---------SLTPDELKEH 510
126436346 440 RLFVVGRDDEMIVSGGENVYPIEVEKTLAAHPGVAEAEVLGVDDEKYGQRLAAFVVPAAGA---------ALTPDELKEH 510
126436699 430 RLFVVGRDDEMIVSGGENVYPIEVEKALATHPEVNEAAVIGVDDEQYGQRLAAFVVLRDGA---------SATPEDLKAH 500
119869862 440 RLFVVGRDDEMIVSGGENVYPIEVEKTLAAHPGVAEAEVLGVDDEKYGQRLAAFVVPAAGA---------SLTPDELKEH 510
118470076 436 RLFVVGRDDEMIVSGGENVYPIEVEKVLTTHPAVAEAAVIGVDDEQFGQRLAAFVVLSGD-----------ATVDDLKSH 504
145221039 434 RLFVVGRDDEMIVSGGENVYPIEVEKTLTSHPDVAEATVLGVDDEKFGQRLAAFVVLNPGA---------AATPEALKQH 504
145223014 429 RLFVVGRDDEMIVSGGENVYPIEVEKTLMSHPEVAEATVLGVEDSEYGQRLAAFVVLTDGS---------GLTPEDLKQH 499
68535363  552 VKAHLARHSVPRHFVYLDKLPRNAVGKVVPRELPQP 587
120401258 505 VRDNLANYKVPREITILDELPRGVTGKISRKDLQDR 540
120405179 495 VRENLANYKVPRDITIMAELPRGSTGKILRNELRGR 530
108800723 511 VRDNLANYKVPRDIVILDELPRGGTGKVLRNELRAH 546
126436346 511 VRDNLANYKVPRDIVILDELPRGGTGKVLRNELRAH 546
126436699 501 VRENLANYKVPRSITVLGELPRGSTGKIVRRELHAL 536
119869862 511 VRDNLANYKVPRDIVILDELPRGGTGKVLRNELRAH 546
118470076 505 VRDNLANYKVPRDITILDELPRNSTGKIARRELQEK 540
145221039 505 VRDNLANYKVPREITVLDELPRSITGKISRKDLKDR 540
145223014 500 VRANLANYKVPRDITILPELPRGSTGKILRNELRGS 535
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap