Conserved Protein Domain Family
PRK13378

?
PRK13378: PRK13378 
protocatechuate 4,5-dioxygenase subunit alpha; Provisional
Statistics
?
PSSM-Id: 139527
View PSSM: PRK13378
Aligned: 14 rows
Threshold Bit Score: 180.702
Threshold Setting Gi: 192289608
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
171060368   4 PLRESGHIDIPGTIIFDGAQAMKGYALNKMCFSFNDAANRTAFLADEDGYCARYGLNGQQREAIRNRNVLQLLAAGGNAY 83 
39934081   16 AGAGRAKREIFGTPIFGPESAQKGYALNKMCFSFNDAGARAAFVKDEAAYCARYGLTAAQTEAILKRDLLKLLDEGGNAY 95 
86748185   10 EAGAYLKRDIFGTPIFGPEAAQKGYALNKMCFSFNSAAARADFVADEAAYCARYGLTATQTEAILKRDLLKLLDHGGNAY 89 
192289608   7 AGAGRAKREIFGTPIFGPESAQKGYALNKMCFSFNDAGARAAFVKDEAAYCARYGLTAAQTEAILKRDLLKLLDEGGNAY 86 
119898814   1 -MATRQKREIPGTSIFDGELAQKGYALNKMCFSFNSADNRAEFQRDEAAYCRKFGLNDEQETAIRTRNVLGLLAAGGNVY 79 
83309356    1 -MAPKTKRVIPGTTLFDGDMARKGYALNKMCFSFNSEENRQEFLKDPGAYCDKFGLNEQQKKAVISLQVLDMLAAGGNAY 79 
113473781   1 --MTTEAQLIPGTTLFDGGAARKGYALNAMCFSFNEKVNRDAFLADEASYMDRYGLTPEQRESVVGRDILGMIAAGGNIY 78 
152997936   1 MASNYTDRKLQGTYLFDGQMAKKGYGLNKMCYSFNDQTARDEFNADPEAYCEKFKLTEAQKEAIRNRDVIGLLREGGSIY 80 
121605628   5 LPRISNLPKIPGTTQFDGEQARKGYALNKMCFSFNSADNRNAFKADEEAYMRQYGLNETQAAAIRARNVLQLIAAGGNAY 84 
160896364   1 ---MADQPQIPGTTLFDGRQARKGYALNSMCFSFNELANRQAFLADEEAYMRSYGLNQEQADAVRARNVLQMIAAGGNAY 77 
171060368  84 YLAKFAGIFGLDMQDIGAQQTGMTKDEFKARLLAARG 120
39934081   96 YLAKFAGILGLNMQDIGALQTGMTVEQFKAKLLAARD 132
86748185   90 YLAKFAGILGLNMQDIGALQTGMSVEQFKAKLLAARD 126
192289608  87 YLAKFAGILGLNMQDIGALQTGMTVEQFKAKLLAARD 123
119898814  80 YLAKFAGILGLDVQDLGAAQTGMTKEAFKAMLVAAGK 116
83309356   80 FIAKLGGIYKLDMQDVGAQQTGVTKEEFQAKLVAAGR 116
113473781  79 YLAKLAGIFGLNVQDVGSMQTGVSVEKFKEMLLAQGR 115
152997936  81 YLAKFTGLLKLNMQDIGGLQTGMSTDEFKAMLEKNGR 117
121605628  85 YLAKFAGIFGLDMQDIGAQQTGLTKDEFKARLIAAGQ 121
160896364  78 YLAKLAGIFHLDMQDIGAQQTGMTKAEFQALLRSHA- 113
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap