Conserved Protein Domain Family
pimE

?
PRK13375: pimE 
mannosyltransferase; Provisional
Statistics
?
PSSM-Id: 172015
View PSSM: PRK13375
Aligned: 35 rows
Threshold Bit Score: 432.234
Threshold Setting Gi: 258654443
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
54026736    1 MNRESARTDARPAAAPLRTALALLGLSVLARMLWM--LLSDNGMNLVDLHVYVDGSASV-LTDRLYDFTYAEKTPDFPLP 77 
108797446   8 RSTVARGVMTRRCRHLTRVAPWLLAVSLALRFVGSipFL---DMLFVDLRVYILGGEALtQPGTLYGLTYIDSYGDH-LP 83 
108797447  27 MRAASALKVRPCLARVVALAPILLAVSIIARLASTmvYYFFAGDAFFDLHVYVIGGAALnHPGTLYDVVYVDPTKGERLP 106
126433065   8 RSTVARGVMTRRCRHLTRVAPWLLAVSLALRFVGSipFL---DMLFVDLRVYILGGEALtQPGTLYGLTYIDSYGDH-LP 83 
126433066  27 MRAASALKVRPCLARVVALAPILLAVSIIARLASTmvYYFFAGDAFFDLHVYVIGGAALnHPGTLYDVVYVDPTKGERLP 106
119866531   8 RSTVARGVMTRRCRHLTRVAPWLLAVSLALRFVGSipFL---DMLFVDLRVYILGGEALtQPGTLYGLTYIDSYGDH-LP 83 
119866533   1 -----MPESGVPAGRRRLLAPLLLVTSAAALLAVT----MANPPDLVDFHVYMLGGVALdRPDTLYSFAYSDQSPDQPLP 71 
119866532  27 MRAASALKVRPCLARVVALAPILLAVSIIARLASTmvYYFFAGDAFFDLHVYVIGGAALnHPGTLYDVVYVDPTKGERLP 106
226365399  19 ERSPTSARGTSPLHTLLRCAPVLLVLSVLGRMAWT--LLSPNGMNLVDLHVYVDGSEAL-HGGSLYDFTYSEVTPDFPLP 95 
111022892  19 ERSPTSSRGASALHGLLRCAPVLLVLSVLGRMAWT--LLSPNGMNLVDLHVYVDGSEAL-RGGSLYDFTYSKVTPDFPLP 95 
54026736   78 FTYPPFAALVFSPLHFLPFTVIAVGWLLATVAALYGVVRISLELLlgrERLrepGWRTATVAWTAVGVWLEPVRTTLDYG 157
108797446  84 FIYPPFAALLFYPLHFLPFPVVAWIWQLAVVAGLYGLVRISQRML---GGGs----HRVAMLWTAAGIWFEPIRTILTCS 156
108797447 107 FTYPAFAAMVFYPLHLLPFGLLAFLWQIALIAAIYASIRISQRLI---GDGa--GGPRVAMLWTAVAIWLEPVASSVQTG 181
126433065  84 FIYPPFAALLFYPLHFLPFPVVAWIWQLAVVAGLYGLVRISQRML---GGGs----HRVAMLWTAAGIWFEPIRTILTCS 156
126433066 107 FTYPAFAAMVFYPLHLLPFGLLAFLWQIALIAAIYASIRISQRLI---GDGa--GGPRVAMLWTAVAIWLEPVASSVQTG 181
119866531  84 FIYPPFAALLFYPLHFLPFPVVAWIWQLAVVAGLYGLVRISQRML---GGGs----HRVAMLWTAAGIWFEPIRTILTCS 156
119866533  72 FVYPPFAAILFRPLTALPFVVAGVLWQLGILAAVYGIVRISQRLL---GGGs----HRTAMLWTAGLIWLEPVRVALDLG 144
119866532 107 FTYPAFAAMVFYPLHLLPFGLLAFLWQIALIAAIYASIRISQRLI---GDGa--GGPRVAMLWTAVAIWLEPVASSVQTG 181
226365399  96 FTYPPFAALVFFPLHYLPFPLVGVGWQLLTILALYAVARMSLGLVlgdAARs-pHWRAVAVLWTTVGVWVEPVRTTLDYG 174
111022892  96 FTYPPFAALVFFPLHYLPFPLVGVGWQLLTILALYALARMSLGLVl-gDAArspHWRAVAVLWTTVGVWVEPVRTTLDYG 174
54026736  158 QVNVFLVLGAMLAVRNSRWWVSGGLVGLIAGIKLTPAITGLYFVARRRWGAAVFSAVAFGGTVAISYLLNNHEATRYFGT 237
108797446 157 QVGVFLTLAVLYAAYTSRSWLSGLLVGLSAGVKVTPAITGLYFVGMRRWAAVCFSLAAFLATVLVSAVIAPQETRQFFGG 236
108797447 182 QVGVFLMLAVLYAAYSSRWWLSGLLVGAGAGVKLTPAITGLYFVGMRRWAAAAFSAVTFFATVGLAYVALPADAGRYFPD 261
126433065 157 QVGVFLTLAVLYAAYTSRSWLSGLLVGLSAGVKVTPAITGLYFVGMRRWAAVCFSLAAFLATVLVSAVIAPQETRQFFGG 236
126433066 182 QVGVFLMLAVLYAAYSSRWWLSGLLVGAGAGVKLTPAITGLYFVGMRRWAAAAFSAVTFFATVGLAYVALPADAGRYFPD 261
119866531 157 QVGVFLTLAVLYAAYTSRSWLSGLLVGLSAGVKVTPAITGLYFVGMRRWAAVCFSLAAFLATVLVSAVIAPQETRQFFGG 236
119866533 145 QVGIFLTLAVLYAVCSRRWWLSGLLVGLAAGVKLTPAITGLYFLGVRRWTAAAFSAVVFVATIGLSYLVVGDQVRNYFTR 224
119866532 182 QVGVFLMLAVLYAAYSSRWWLSGLLVGAGAGVKLTPAITGLYFVGMRRWAAAAFSAVTFFATVGLAYVALPADAGRYFPD 261
226365399 175 QINVFLALLVMTAVRSSRWWLSGALVGFAAGIKLTPAITGLYFLMQRRWKAAVFSGVAFAATVGVSYLLIGSEAREYFTH 254
111022892 175 QINVFLALLVMTAVRSSRWWLSGALVGFAAGIKLTPAITGLYFLMQRRWKAAVFSGVAFAATVGVSYLLIGSEAREYFTH 254
54026736  238 LLGDADRIGPVASVWNQSLRGTLSRILGYDVETGPIWIAAVLLVAVPAFFAWRALG---PD-DLLGTLLVVQLFGLLVSP 313
108797446 237 LFSRVPM--PTATCLNQSWRGTVSRIVGYDAGRSLVLLVAIGVTAVLALLAWRELGrgpGGrDALASLLVVQLFGLTASP 314
108797447 262 QMTEAGTTLPIGSSWNQSWLGGLSRILGYDPGLHPLVIAAVAVTALLAALAWRALGsadGR-DRLASLLVVQFLGLMASP 340
126433065 237 LFSRVPM--PTATCLNQSWRGTVSRIVGYDAGRSLVLLVAIGVTAVLALLAWRELGrgpGGrDALASLLVVQLFGLTASP 314
126433066 262 QMTEAGTTLPIGSSWNQSWLGGLSRILGYDPGLHPLVIAAVAVTALLAALAWRALGsadGR-DRLASLLVVQFLGLMASP 340
119866531 237 LFSRVPM--PTATCLNQSWRGTVSRIVGYDAGRSLVLLVAIGVTAVLALLAWRELGrgpGGrDALASLLVVQLFGLTASP 314
119866533 225 VMGDTS-INPIGIALNQSWRGAISRFLGHDAGGSALVIAAIAGTAVLALFAWAALGagsRPrDRLGSVLVVQLFGLLMSP 303
119866532 262 QMTEAGTTLPIGSSWNQSWLGGLSRILGYDPGLHPLVIAAVAVTALLAALAWRALGsadGR-DRLASLLVVQFLGLMASP 340
226365399 255 LLGDADRIGPVGSVWNQSLRGALSRLLGYDVETGVLWLLAVAVTVVLAVLAWRAIA---RD-DRLGTLVLVELLGLLVSP 330
111022892 255 LLGDADRIGPVGSVWNQSLRGALSRLLGYDVETGALWLLAVTVTVVLAALAWRAIA---RD-DRLGTLVIVELLGLLVSP 330
54026736  314 ISWSHHWVWLLPLVLWLVYGPLRQAPGARVLAGYWLLTMLVGVPWVLSFFQPTIWEISRPGLLSWLGAVDVLGVLACYVW 393
108797446 315 ISWAHHWVWVVPLTIWLLHGPWRGRAGARVLGSGWIALMVIGVPTLLSGQQADLSTFSRPWYLAVAAAVYVPMTLVTFAW 394
108797447 341 VSWIHHWVWVIPLIIWLIHGPWRERAGARLLGLGWLALMVISVPSLLSLAQPDIWEISRPWYLAWAEMVYIVASLSTLAW 420
126433065 315 ISWAHHWVWVVPLTIWLLHGPWRGRAGARVLGSGWIALMVIGVPTLLSGQQADLSTFSRPWYLAVAAAVYVPMTLVTFAW 394
126433066 341 VSWIHHWVWVIPLIIWLIHGPWRERAGARLLGLGWLALMVISVPSLLSLAQPDIWEISRPWYLAWAEMVYIVASLSTLAW 420
119866531 315 ISWAHHWVWVVPLTIWLLHGPWRGRAGARVLGSGWIALMVIGVPTLLSGQQADLSTFSRPWYLAVAAAVYVPMTLVTFAW 394
119866533 304 ISWVHHWAWVVPLVLWLLSGPWRNEPGARVLGWGWLALTFVGVPSQLSLLEPSLWEISRPWYLAWAGLAYVVAAVATLGW 383
119866532 341 VSWIHHWVWVIPLIIWLIHGPWRERAGARLLGLGWLALMVISVPSLLSLAQPDIWEISRPWYLAWAEMVYIVASLSTLAW 420
226365399 331 ISWSHHWVWVIPMLIWLLHGPYGSMLGTRILAGYWLVTTLIGVPWVLSFFQDSIWLISRPAVLAWLGTVDVVGAFGVYLW 410
111022892 331 ISWSHHWVWVIPMLIWLLHGPYGSMLGTRILAGYWLVTTLIGVPWVLSFFQDSIWLISRPAVLAWLGTVDVVGAFGVYAW 410
54026736  394 VIVAGRR---------------ARATAPEPERAGL 413
108797446 395 IIVASRTg--------------TRRTCPPSEPKAE 415
108797447 421 IIRTGRR---------------A------------ 428
126433065 395 IIVASRTg--------------TRRTCPPSEPKAE 415
126433066 421 IIRTGRR---------------A------------ 428
119866531 395 IIVASRTg--------------TRRTCPPSEPKAE 415
119866533 384 IVLTGRR---------------NAAPTPPVRRRFA 403
119866532 421 IIRTGRR---------------A------------ 428
226365399 411 VAYAGRRtnrpaeavgdisppvSRSAQQDPDPAA- 444
111022892 411 VAYAGRRtkravaa-apvsppvSRSAQQDPDPTA- 443
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap