Conserved Protein Domain Family
PRK13373

?
PRK13373: PRK13373 
putative dioxygenase; Provisional
Statistics
?
PSSM-Id: 106331
View PSSM: PRK13373
Aligned: 2 rows
Threshold Bit Score: 684.905
Threshold Setting Gi: 33603105
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33603105   1 MAKIVAGIGMSHAPGALGWPDAPSASVRRRLLQAADRLGRSLDAARPDVIIAFLDDHFENHFRSLMPTVGIGVADSHPGP 80 
33598209   1 MAKIVAGIGMSHAPGALGWQDAPSASVRRRLLQAADRLGRSLDAARPDVIIAFLDDHFENHFRSLMPTVGIGVADSHPGP 80 
33603105  81 ATQWLEALRLTRQERFGGAPEIAERLLRSLVADGYDVARMGEIEYGNNLMVPWKLMAPRSAPAIIPVFTNVFSPPVMPYR 160
33598209  81 ATQWLEALRLTRQERFGGAPEIAERLLRSLVADGYDVARMGEIEYGNNLMVPWKLMAPRSAPAIIPVFTNVFSPPVMPYR 160
33603105 161 RAYAFGAALRNAAEALDADLRVAFMATGGMSHWPPFWNDSSPEADAFLARMKAFQTHGKSVLEKDPHLLRDLAAYEIEMA 240
33598209 161 RAYAFGAALRNAAEALDADLRVAFMATGGMSHWPPFWNDSSPEADAFLARMKAFQTHGKSVLEKDPHLLRDLAAYEIEMA 240
33603105 241 ERNQWPLNSPHPLVNEAWDRQMLDALARGDVEFLCGLQYEDVKRDGGHGGQEIINWIELMGAMKGAPATLLEYEAVTEWI 320
33598209 241 ERNQWPLNSPHPLVNEAWDRQMLDALARGDVEFLCGLQYEDVKRDGGHRGQEIINWIELMGAMKGAPATLLEYEAVTEWI 320
33603105 321 CGMAYMDYGVAQAWPVNPLIKEQE 344
33598209 321 CGMAYMDYGVAQAWPVNPLIKEQE 344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap