Conserved Protein Domain Family
pcmA

?
PRK13372: pcmA 
protocatechuate 4,5-dioxygenase subunit alpha/beta
Links
?
Statistics
?
PSSM-Id: 106330
View PSSM: PRK13372
Aligned: 2 rows
Threshold Bit Score: 926.738
Threshold Setting Gi: 116662337
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
121607173   1 MSLDKPYLDVPGTIIFDAEQSRKGYWLNQFCMSLMQADNRARFKADERAYLDRWALTEAQKQAVLARDLNQCLRLGGNIY 80 
116662337   1 MTLDKPYKDVPGTTIFDADQARKGYNLNQFCMSLMKPENRERYLADRGAYLDEWPLNPVQRQAVLDIDLNTCIAEGGNIY 80 
121607173  81 FLAKIGATDGKSFQQMAGSMTGLSEEQYRDMMISGGRPANGLRVPGENGATRTQPAPPAQpTGARPAKARISAAVFSSHV 160
116662337  81 FLAKIGATHGLSFQQMAGSMTGMSEAAYRDMMIGGGRRPEGNRLKDLDGWTPPEPGEKAE-TVRQDAPAQYTSALFTSHV 159
121607173 161 PAIGAAIDQGKTQQDYWKPLFAGYDLSRQWLREHRPDVILLVYNDHATAFSLEMIPTFAIGTAAQFQPADEGWGPRPVPP 240
116662337 160 PAIGAAMDLGKTEEPYWKKVFSGYEWTREWAKENLPDVVILVYNDHATAFDSSIIPTFVLGTGAEYPVADEGYGPRPVPD 239
121607173 241 VIGHPELAAHIAQSVIQQDFDLTIVNKMDVDHGLTVPLSLMCGQPLAWPCPVIPFAVNVVQYPVPSGRRCYQLGQAIRRA 320
116662337 240 VKGYPELAAHIAQSVIQDDFDLTLVNEMVVDHGLTVPLSLVYGDVEEWPVRVIPLAVNVVQYPVPSGRRCYELGRALRRA 319
121607173 321 IESYDAD-LNVQIWGTGGMSHQLQGPRAGLINKEFDNAFLDQLITDPEAAASIPHIDYVREAGSEGIELVMWLIARGAMS 399
116662337 320 LDKWDGEpLNVQIWGTGGMSHQLQGPRAGLINEEWDNAFLDHLIADPVGLTEWQHMEYVDEAGSEGIELVDWLIARGAMD 399
121607173 400 DVARGATPDaaadgatgrppkVVHRFYHVPASNTAVGHLILENP 443
116662337 400 DQFGGESPE------------VNHRFYHVPASNTAVGHLVLTNP 431
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap