Conserved Protein Domain Family
PRK13350

?
PRK13350: PRK13350 
superantigen-like protein SSL12; Reviewed
Statistics
?
PSSM-Id: 171995
View PSSM: PRK13350
Aligned: 16 rows
Threshold Bit Score: 366.211
Threshold Setting Gi: 224475929
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82750773    1 MNKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHFSFSNKWLYQYDNGNIYVELK 80 
15924156    1 MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHFSFSNKWLYQYDNGNIYVELK 80 
15926749    1 MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHFSFSNKWLYQYDNGNIYVELK 80 
21282776    1 MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHFSFSNKWLYQYDNGNIYVELK 80 
49483328    1 MRKCIMKKLILMTTLLLLGTTATQTSNSPLNVSTDAKAYHIGQDETNINELIKYYTQLPLTFSNRWLYQYDDGNIYVEFK 80 
49486004    1 MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHFSFSNKWLYQYDNGNIYVELK 80 
148267657   1 MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHFSFSNKWLYQYDNGNIYVELK 80 
150393715   1 MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHFSFSNKWLYQYDNGNIYVELK 80 
156979487   1 MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHFSFSNKWLYQYDNGNIYVELK 80 
269202779   1 MSKNITKNIILTTTLLLLGTVLPQNQKPVFSFYSEAKAYSIGQDETNINELIKYYTQPHFSFSNKWLYQYDNGNIYVELK 80 
82750773   81 RYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQLWWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAH 160
15924156   81 RYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQLWWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAH 160
15926749   81 RYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQLWWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAH 160
21282776   81 RYSWSAHISLWGAESWGNINQLKGRYVDVFGLKDKDTDQLWWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAH 160
49483328   81 RYSWSAHIRLWGAESWGNVNQLRDRYVDVFGLKDEDTSQLWWVYRDTFTGGVTPAASPSDKPYSLFVQYKDKLQTIIGAH 160
49486004   81 RYSWSAHISLWGAESWGNINQLKGRYVDVFGLKDKDTDQLWWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAH 160
148267657  81 RYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQLWWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAH 160
150393715  81 RYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQLWWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAH 160
156979487  81 RYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQLWWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAH 160
269202779  81 RYSWSAHISLWGAESWGNINQLKDRYVDVFGLKDKDTDQLWWSYRETFTGGVTPAAKPSDKTYNLFVQYKDKLQTIIGAH 160
82750773  161 KIYQGNKPILTLKEIDFRAREALIKNKILYNENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD 238
15924156  161 KIYQGNKPVLTLKEIDFRAREALIKNKILYTENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD 238
15926749  161 KIYQGNKPVLTLKEIDFRAREALIKNKILYTENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD 238
21282776  161 KIYQGNKPVLTLKEIDFRAREALIKNKILYNENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD 238
49483328  161 KMYQGNKPILTLKEIDFRARETLIKNKILYHENRNKGKLKITGGGNDFTIDLSKRLHSDLANVYVKNPQKITVEVLID 238
49486004  161 KIYQGNKPVLTLKEIDFRAREALIKNKILYNENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD 238
148267657 161 KIYQGNKPVLTLKEIDFRAREALIKNKILYTENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD 238
150393715 161 KIYQGNKPVLTLKEIDFRAREALIKNKILYTENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD 238
156979487 161 KIYQGNKPVLTLKEIDFRAREALIKNKILYTENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD 238
269202779 161 KIYQGNKPVLTLKEIDFRAREALIKNKILYTENRNKGKLKITGGGNNYTIDLSKRLHSDLANVYVKNPNKITVDVLFD 238
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap