Conserved Protein Domain Family
PRK13346

?
PRK13346: PRK13346 
superantigen-like protein SSL7; Reviewed
Statistics
?
PSSM-Id: 106304
View PSSM: PRK13346
Aligned: 14 rows
Threshold Bit Score: 437.9
Threshold Setting Gi: 82750140
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82750140    1 MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQKGQ 80 
88194187    1 MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQENQ 80 
21282117    1 MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQENQ 80 
49485294    1 MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQENQ 80 
148266888   1 MKLKTLAKATLALGLLTTGVITSEGQAVHAKEKQERVQHLYDIKDLYRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQ 80 
150392933   1 MKLKTLAKATLALGLLTTGVITSEGQAVHAKEKQERVQHLYDIKDLYRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQ 80 
156978755   1 MKLKTLAKATLALGLLTTGVITSEGQAVHAKEKQERVQHLYDIKDLYRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQ 80 
151220606   1 MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQENQ 80 
269202049   1 MKLKTLAKATLALGLLTTGVITSEGQAVHAKEKQERVQHLYDIKDLYRYYSSESFEFSNISGKVENYNGSNVVRFNQEKQ 80 
87162297    1 MKLKTLAKATLALGLLTTGVITSEGQAVQAKEKQERVQHLYDIKDLHRYYSSESFEFSNISGKVENYNGSNVVRFNQENQ 80 
82750140   81 NHQLFLLGKDKEEYKEGIEGKDVFVVKELIDPNGRLSTVGGVTKKNNQSSETNTPLVVNKVYGGDLHASIDSFSINKEEV 160
88194187   81 NHQLFLLGKDKEKYKEGIEGKDVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFSINKEEV 160
21282117   81 NHQLFLSGKDKDKYKEGLEGQNVFVVKELIDPNGRLSTVGGVTKKNNQSSETNTPLFIKKVYGGNLDASIESFLINKEEV 160
49485294   81 NHQLFLSGKDKDKYKEGLEGQNVFVVKELIDPNGRLSTVGGVTKKNNQSSETNTPLFIKKVYGGNLDASIESFLINKEEV 160
148266888  81 NHQLFLLGKDKDKYKKGLEGQNVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFLINKEEV 160
150392933  81 NHQLFLLGKDKDKYKKGLEGQNVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFLINKEEV 160
156978755  81 NHQLFLLGKDKDKYKKGLEGQNVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFLINKEEV 160
151220606  81 NHQLFLLGKDKEKYKEGIEGKDVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFSINKEEV 160
269202049  81 NHQLFLLGKDKDKYKKGLEGQNVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFLINKEEV 160
87162297   81 NHQLFLLGKDKEKYKEGIEGKDVFVVKELIDPNGRLSTVGGVTKKNNKSSETNTHLFVNKVYGGNLDASIDSFSINKEEV 160
82750140  161 SLKELDFKIRKQLVEKYGLYQGTSKYGKITIILNDGKKEVIDLGDKLQFERMGDVLNSKDINKIEVTLKQI 231
88194187  161 SLKELDFKIRQHLVKNYGLYKGTTKYGKITINLKDGEKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI 231
21282117  161 SLKELDFKIRQHLVKNYGLYKGTTKYGKITFNLKDGEKQEIDLGDKLQFEHMGDVLNSKDIQNIAVTINQI 231
49485294  161 SLKELDFKIRQHLVKNYGLYKGTTKYGKITFNLKDGEKQEIDLGDKLQFEHMGDVLNSKDIQNIAVTINQI 231
148266888 161 SLKELDFKIRKQLVEKYGLYKGTTKYGKITINLKDEKKEVIDLGDKLQFERMGDVLNSKDIQNIAVTINQI 231
150392933 161 SLKELDFKIRKQLVEKYGLYKGTTKYGKITINLKDEKKEVIDLGDKLQFERMGDVLNSKDIQNIAVTINQI 231
156978755 161 SLKELDFKIRKQLVEKYGLYKGTTKYGKITINLKDEKKEVIDLGDKLQFERMGDVLNSKDIQNIAVTINQI 231
151220606 161 SLKELDFKIRQHLVKNYGLYKGTTKYGKITINLKDGEKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI 231
269202049 161 SLKELDFKIRKQLVEKYGLYKGTTKYGKITINLKDEKKEVIDLGDKLQFERMGDVLNSKDIQNIAVTINQI 231
87162297  161 SLKELDFKIRQHLVKNYGLYKGTTKYGKITINLKDGEKQEIDLGDKLQFERMGDVLNSKDINKIEVTLKQI 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap