Conserved Protein Domain Family
PRK13345

?
PRK13345: PRK13345 
superantigen-like protein SSL9; Reviewed
Statistics
?
PSSM-Id: 106303
View PSSM: PRK13345
Aligned: 15 rows
Threshold Bit Score: 393.217
Threshold Setting Gi: 15923418
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82750142    1 MKFTALAKATLALGILTTGVFTAESKAVHAKVELDETQCKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNK 80 
88194189    1 MKLTTIAKATLALGILTTGVFTAESQTGHAKVELDETQRKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNK 80 
57651314    1 MKLTTIAKATLALGILTTGVFTAESQTGHAKVELDETQRKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNK 80 
15926106    1 MKLTALAKATLALGILTTGVFTAESKAVHAKVELDETQRKYYINMLHQYYSEESFESTNISVKSEDYYGSNVLNFNQRNK 80 
148266890   1 MKLTALAKATLALGILTTGVFTAESKAVHAKVELDETQRKYYINMLHQYYSEESFESTNISVKSEDYYGSNVLNFNQRNK 80 
150392935   1 MKLTALAKATLALGILTTGVFTAESKAVHAKVELDETQRKYYINMLHQYYSEESFESTNISVKSEDYYGSNVLNFNQRNK 80 
156978757   1 MKLTALAKATLALGILTTGVFTAESKAVHAKVELDETQRKYYINMLHQYYSEESFESTNISVKSEDYYGSNVLNFNQRNK 80 
151220608   1 MKLTTIAKATLALGILTTGVFTAESQTGHAKVELDETQRKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNK 80 
269202051   1 MKLTALAKATLALGILTTGVFTAESKAVHAKVELDETQRKYYINMLHQYYSEESFESTNISVKSEDYYGSNVLNFNQRNK 80 
87161416    1 MKLTTIAKATLALGILTTGVFTAESQTGHAKVELDETQRKYYINMLHQYYSEESFEPTNISVKSEDYYGSNVLNFKQRNK 80 
82750142   81 AFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQK 160
88194189   81 AFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQK 160
57651314   81 AFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQK 160
15926106   81 TFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKHGFSINELFFIQK 160
148266890  81 TFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKHGFSINELFFIQK 160
150392935  81 TFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKHGFSINELFFIQK 160
156978757  81 TFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKHGFSINELFFIQK 160
151220608  81 AFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQK 160
269202051  81 TFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKHGFSINELFFIQK 160
87161416   81 AFKVFLLGDDKNKYKEKTHGLDVFAVPELIDIKGGIYSVGGITKKNVRSVFGFVSNPSLQVKKVDAKNGFSINELFFIQK 160
82750142  161 EEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKKIKNIEVNLN 232
88194189  161 EEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN 232
57651314  161 EEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN 232
15926106  161 EEVSLKELDFKIRKMLVEKYRLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSKQIKNIEVNLN 232
148266890 161 EEVSLKELDFKIRKMLVEKYRLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSKQIKNIEVNLN 232
150392935 161 EEVSLKELDFKIRKMLVEKYRLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSKQIKNIEVNLN 232
156978757 161 EEVSLKELDFKIRKMLVEKYRLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSKQIKNIEVNLN 232
151220608 161 EEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN 232
269202051 161 EEVSLKELDFKIRKMLVEKYRLYKGASDKGRIVINMKDEKKYVIDLSEKLSFDRMFDVMDSKQIKNIEVNLN 232
87161416  161 EEVSLKELDFKIRKLLIEKYRLYKGTSDKGRIVINMKDEKKHEIDLSEKLSFERMFDVMDSKQIKNIEVNLN 232
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap