Conserved Protein Domain Family
PRK13335

?
PRK13335: PRK13335 
superantigen-like protein SSL3; Reviewed
Statistics
?
PSSM-Id: 139494
View PSSM: PRK13335
Aligned: 15 rows
Threshold Bit Score: 604.427
Threshold Setting Gi: 82750138
Created: 9-Dec-2010
Updated: 26-Jul-2017
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
88194182    1 MKMRTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80 
82750138    1 MKMRTIAKTSLALGLLTTGAITVTTQSVKAE--------KVPMLKAERLAMINITTGANTATTQAANTRQERTPKLEKAP 72 
57651311    1 MKMRTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80 
21282113    1 MKMRTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80 
49485290    1 MKMRTITKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80 
148266885   1 MNMKTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80 
150392930   1 MNMKTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80 
151220602   1 MKMRTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80 
269202046   1 MNMKTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80 
87161535    1 MKMRTIAKTSLALGLLTTGAITVTTQSVKAEkiqstkvdKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAP 80 
88194182   81 NTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
82750138   73 NTNEEKTSASKIEKISQPKQEAQKSLNISATPAPKQEQSQTTTESTTPKTKVTTPPSINTPQPMQSTKSDTPQSPTIKQA 152
57651311   81 NTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
21282113   81 NTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTQQTKMTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
49485290   81 NTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTQQTKMTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
148266885  81 NTNEEKTSASKIEKISQPKQEEQKSLNISAMPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
150392930  81 NTNEEKTSASKIEKISQPKQEEQKSLNISAMPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
151220602  81 NTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
269202046  81 NTNEEKTSASKIEKISQPKQEEQKSLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
87161535   81 NTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQA 160
88194182  161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
82750138  153 QTDMTPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 232
57651311  161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
21282113  161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFLLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
49485290  161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFLLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
148266885 161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFLLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
150392930 161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFLLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
151220602 161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
269202046 161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFLLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
87161535  161 QTDMTPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQ 240
88194182  241 LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
82750138  233 LKKYSVGGITKTNSKKVDHKAELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVTKM 312
57651311  241 LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
21282113  241 LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
49485290  241 LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
148266885 241 LKKYSVGGITKTNSKKVDHKAELSVTKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
150392930 241 LKKYSVGGITKTNSKKVDHKAELSVTKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
151220602 241 LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
269202046 241 LKKYSVGGITKTNSKKVDHKAELSVTKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
87161535  241 LKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKM 320
88194182  321 KNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK 356
82750138  313 KNGGKYTFELHKKLQEHRMADVIEGTNIDKIEVNIK 348
57651311  321 KNGGKYTFELHKKLQEHRMA----GTNIDNIEVNIK 352
21282113  321 KNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK 356
49485290  321 KNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK 356
148266885 321 KNGGKYTFELHKKLQEHRMADVIEGTNIDKIEVNIK 356
150392930 321 KNGGKYTFELHKKLQEHRMADVIEGTNIDKIEVNIK 356
151220602 321 KNGGKYTFELHKKLQEHRMA----GTNIDNIEVNIK 352
269202046 321 KNGGKYTFELHKKLQEHRMADVIEGTNIDKIEVNIK 356
87161535  321 KNGGKYTFELHKKLQEHRMA----GTNIDNIEVNIK 352
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap