Conserved Protein Domain Family
PRK13324

?
PRK13324: PRK13324 
type III pantothenate kinase
Statistics
?
PSSM-Id: 106284
View PSSM: PRK13324
Aligned: 9 rows
Threshold Bit Score: 461.402
Threshold Setting Gi: 89256938
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
118498167   1 MLLVMDVGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLSKIDGCGISSVVPHLNYSLGSAVIK 80 
167627239   1 MLLVMDVGNSHIHIGVFEGENIISQIRYATSSVDSTSDQIGVFLRQALRENSVDLSKIKGCAISSVVPHLNYSLGSAVIK 80 
56707286    1 MLLVMDMGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGCGISSVVPHLNYSLGSAVIK 80 
110669756   1 MLLVMDMGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGCGISSVVPHLNYSLGSAVIK 80 
134301323   1 MLLVMDMGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGCGISSVVPHLNYSLGSAVIK 80 
89256938    1 MLLVMDMGNSHIHIGVFDGDIIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGYGISSVVPHLNYSLGSAVIK 80 
115315302   1 MLLVMDMGNSHIHIGVFDGDIIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGYGISSVVPHLNYSLGSAVIK 80 
156503128   1 MLLVMDMGNSHIHIGVFDGDIIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGYGISSVVPHLNYSLGSAVIK 80 
187931056   1 MLLVMDMGNSHIHIGVFDGDRIVSQIRYATSSVDSTSDQMGVFLRQALRENSVDLGKIDGCGISSVVPHLNYSLGSAVIK 80 
118498167  81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
167627239  81 YFGMKPFFISMETTDLDMTAVEAHQVGADRIASCIGAIADYPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
56707286   81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
110669756  81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
134301323  81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
89256938   81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
115315302  81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
156503128  81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
187931056  81 YFNIKPFFISMDTTDLDMSAVEAHQVGADRIASCISAIADHPNKDLLIIDLGTATTFDLVTKDKKYLSGSIMPGVKLSLN 160
118498167 161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYTIATGGFAGLFKEEDIFDEISPD 240
167627239 161 ALCQGASQLSSITIVKPEVAIGYDTKTNIRSGLYYGHLGALRELKTRSLKEFGAPVYTIATGGFAGLFKDEGIFDEISPD 240
56707286  161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 240
110669756 161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 240
134301323 161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 240
89256938  161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGAL----RRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 236
115315302 161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGAL----RRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 236
156503128 161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGAL----RRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 236
187931056 161 ALCQGASQLSSVTIVKPEVAIGYDTKTNIRSGLYYGHLGALKELKRRSVEEFGSPVYTIATGGFAGLFKEEDIFNEISPD 240
118498167 241 LILRGIRIAFLENNKKGV 258
167627239 241 LILRGIRIAFLENNKKGV 258
56707286  241 LILRGIRIAFLENNKKGV 258
110669756 241 LILRGIRIAFLENNKKGV 258
134301323 241 LILRGIRIAFLENNKKGV 258
89256938  237 LILRGIRIAFLENNKKGV 254
115315302 237 LILRGIRIAFLENNKKGV 254
156503128 237 LILRGIRIAFLENNKKGV 254
187931056 241 LILRGIRIAFLENNKKGV 258
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap