Conserved Protein Domain Family
PRK13312

?
PRK13312: PRK13312 
staphylobilin-forming heme oxygenase IsdG
Statistics
?
PSSM-Id: 139480
View PSSM: PRK13312
Aligned: 15 rows
Threshold Bit Score: 194.177
Threshold Setting Gi: 156979458
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82750743    1 MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHV 80 
161376697   1 MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHV 80 
21282747    1 MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHV 80 
49483298    1 MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHV 80 
49485973    1 MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHV 80 
148267628   1 MKFMAENRLTLTKGTAKDIIERLYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHV 80 
156979458   1 ---MAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHV 77 
151221259   1 MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHV 80 
269202748   1 MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHV 80 
87162314    1 MKFMAENRLTLTKGTAKDIIERFYTRHGIETLEGFDGMFVTQTLEQEDFDEVKILTVWKSKQAFTDWLKSDVFKAAHKHV 80 
82750743   81 RSKNEDESSPIINNKVITYDIGYSYMK 107
161376697  81 RSKNEDESSPIINNKVITYDIGYSYMK 107
21282747   81 RSKNEDESSPIINNKVITYDIGYSYMK 107
49483298   81 RSKNEDESSPIINNKVITYDIGYSYMK 107
49485973   81 RSKNEDESSPIINNKVITYDIGYSYMK 107
148267628  81 RSKNEDESSPIINNKVITYDIGYSYMK 107
156979458  78 RSKNEDESSPIINNKVITYDIGYSYMK 104
151221259  81 RSKNEDESSPIINNKVITYDIGYSYMK 107
269202748  81 RSKNEDESSPIINNKVITYDIGYSYMK 107
87162314   81 RSKNEDESSPIINNKVITYDIGYSYMK 107
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap