Conserved Protein Domain Family
PRK13297

?
PRK13297: PRK13297 
tRNA CCA-pyrophosphorylase; Provisional
Statistics
?
PSSM-Id: 139469
View PSSM: PRK13297
Aligned: 5 rows
Threshold Bit Score: 611.615
Threshold Setting Gi: 187476684
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
33599196    1 MSRADDPGVAGLQVYIVGGAVRDGLLGLPAGDRDWVVVGATPEDMARRGFIPVGGDFPVFLHPRTKEEYALARTERKSGR 80 
33594921    1 MSRTDDPGVAGLQVYIVGGAVRDGLLGLPAGDRDWVVVGATPEDMARRGFIPVGGDFPVFLHPRTKEEYALARTERKSGR 80 
33593986    1 MSRTDDPGVAGLRVYIVGGAVRDDLLGLPAGDRDWVVVGATPEDMARRGFIPVGGDFPVFLHPRTKEEYALARTERKSGR 80 
187476684   1 --MSADAAVAGLNAYIVGGAVRDALLGLPAGDRDWVVVGATPEEMARRGFIPVGGDFPVFLHPRTKEEYALARTERKSGR 78 
163859075   6 PTTAHDPDCDGLQVYIVGGAVRDALLGQPAGDRDWVVVGATPEDMARRGFIPVGGDFPVFLHPRTKEEYALARTERKSGR 85 
33599196   81 GYKGFTFYTGADVTLEQDLQRRDLTVNAIARTPQGELVDPLDGVADVRARVLRHVGEAFAEDPVRILRLGRFAARFGDFS 160
33594921   81 GYKGFTFYTGADVTLEQDLQRRDLTVNAIARTPQGELVDPLDGVADVRARVLRHVGEAFAEDPVRILRLGRFAARFGDFS 160
33593986   81 GYKGFTFYTGADVTLEQDLQRRDLTVNAIARTPQGELVDPLDGVADVRARVLRHVGEAFAEDPVRILRLGRFAARFGDFS 160
187476684  79 GYKGFTFYTGSDVTLEQDLRRRDFTVNAIARAPGGELIDPLGGQADLRARCFRHVGEAFAEDPVRILRLGRFAARFTDFD 158
163859075  86 GYKGFTFYTGADVTLEQDLLRRDLTVNAIARTPQGQLLDPLNGAADVRARVLRHVGEAFAEDPVRILRLGRFAARFGDFT 165
33599196  161 IAPETMQLCRRMVEAGEADALVPERVWKEVSRGLMAQAPSRMLDVLARAGALARVMPELHDDAAVRAEIDRAAAAGLPLA 240
33594921  161 IAPETMQLCRRMVEAGEADALVPERVWKEVSRGLMAQAPSRMLDVLARAGALARVMPELHDDAAVRAEIDRAAAAGLPLA 240
33593986  161 IAPETMQLCRRMVEAGEADALVPERVWKEVSRGLMAQAPSRMLDVLARAGALARVMPELHDDTAVRAEIDRAAAAGLPLA 240
187476684 159 IAPETLALCRQMVEQGEVDALVPERVWKELSRGLMETMPSRMLSVWARCGALARVMPQLRQWETVAPDLDEAARRGLALP 238
163859075 166 VAPDTLALCRRMVENGEVDALVPERVWKELSRGLMAATPSRMLDVLAQSGALARVMPQLQDIDIVSADLDRAAAAGLPLP 245
33599196  241 GRYALLCRHTPERDALGRRLRAPVECMDQARLLPLAVDALAASATPAAQLDLIERCDALRKPERFDALLQAAAIVAPVDL 320
33594921  241 GRYALLCRHTPERDALGRRLRAPVECMDQARLLPLAVDALAASASTAAQLDLIERCDALRKPERFDALLQAAAIVAPVDL 320
33593986  241 GRYALLCRHTPERDALGRRLRAPVECMDQARLLPLAVDALAASATPAAQLDLIERCDALRKPERFDALLQAAAIVAPVDL 320
187476684 239 GRYALLSRLSTEPLA----LRVPADCADMARLLPEWLRALPA-PLPAQRLDLIERCDGLRKPERFMALAEAVAVVAEVDA 313
163859075 246 GRYALLCRLAPERDALSRRLRVPTECADQARLLPRVVDQAGA-ADPPAQLALMESCDALRKPDRYAALLQAAAVVVAVDQ 324
33599196  321 SAWRARVQAVRAIDAGAIARQCAGDPARIKPALRQARLQALGGA 364
33594921  321 SAWRARVQAVRAIDAGAIARQCAGDPARIKPALRQARLQALGGA 364
33593986  321 SAWRARVQAVRAIDAGAIARQCAGDPARIKPALRQARLQALGGA 364
187476684 314 QAWRRDLDAVRGVDAAAVARQCAGDPARIKPALRQVRLDTLV-- 355
163859075 325 PAWQRRVDAVRGVDAGAIARQCAGDPARIKPALQQARLDALAAL 368
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap